SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025382 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025382
Domain Number 1 Region: 564-611
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 2 Region: 644-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000625
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 698-756
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000236
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025382   Gene: ENSMODG00000020291   Transcript: ENSMODT00000025833
Sequence length 933
Comment pep:novel chromosome:BROADO5:3:233609195:233671329:1 gene:ENSMODG00000020291 transcript:ENSMODT00000025833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNILLYSIVLSALISGSQACYCERYPWTSWSSCSSSCNYGSQIRERHIVRDKYYEENY
CDQLCTKRESRACNQQMCPINCLMGDFEPWSECDPCVKKQFRMRSILRPSQFGGQPCTEQ
LVTSQKCYSTKLCNIEDIDCKNKFKCDSGRCIAMNLLCNEENDCGDSSDEKNCDRKKKVC
NRVYQPIPSVQLMGNGFHILAGEPRGEVLDNAFMGGKCRTVRSSRTSNPYRVPANIESIN
FEVNNEEDDLQTDFYSNLIPLGNDHVLHKSDNLQGNSHSGIPLLWSTKRKERITQQYSFK
KAIQASHKKDSSFIRVHKVISVLNFTMKPTELQLSDVFLKALNHLPLQYNYALYSRLFDD
FGTHYFTSGSMGGTYDLLYQYSREELKNSGLTEEESQHCVRIETVKRRLVFKKKKVENRC
TTNKMLDRYEGSFLQGAEKSLSLVRGGRSEHAAALAWEKKGSSPEETVFTEWLQSVKENP
AVVDFELAPILDLVKNIPCAVTKRKNLKQALHEYAEKFDPCKCAHCPNNGKPTLSGTECL
CVCQSGTYGENCEIRAPDYTSNEVDGAWSCWSSWSPCAASYKRQRTRECNNPAPQNGGKP
CVGEQEQEEDCSFSIFENRGDLCINDEEAEKEVDIDETNPESGCVKPIPPENGFLRNEKR
LYSVGEEAEVACMMGFNLVGYPYLRCLPDQTWRQEGVECQRVGCIKPFVQEGISITPYQS
VYDIGNTIKLTCPYGFAITGPPNYLCGKQSWEPAIPSSLTCRQDILPFPENCGPGHKLVE
SKCVCMSPEEDCSHYSEDLCVFNSESNHYFTKPSCKFLAEKCANAQKLHFLSAGACQDGP
QLERAIERIKLSYNSTKKEPCGYDTCYDWESCSASTSTCFCLMPYQCPKNGSQVYCIRTG
SSKTEKTMNICALGTLYCAQKKVEIVHHGQCIA
Download sequence
Identical sequences F7BFY4
XP_001371538.1.35504 XP_007487473.1.35504 XP_007487474.1.35504 ENSMODP00000025382 ENSMODP00000025382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]