SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025395 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025395
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-16
Family Caspase recruitment domain, CARD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025395   Gene: ENSMODG00000020300   Transcript: ENSMODT00000025846
Sequence length 801
Comment pep:novel chromosome:BROADO5:3:233998905:234011873:-1 gene:ENSMODG00000020300 transcript:ENSMODT00000025846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEIIEKERQNFVKILQQDPDSVLDTLISRNLISEEEYEILDTVTDPLKKSRKMLILVQ
KKGERSCQQFLECLHSAFPESTTGWWSILGHEKAKAPIFTEENKNSEVTLLSEKKQYKST
DDFMFVEEESQNLKTTGSLGNKGLSNSEVSLSSKEKEEEGDDDKLEDTVYSEDREAHEDL
EAIVYLGEEWEDENPDIDLYLGEEDYAESVAYFEEPGSAEEEEASVEYTEYYGENDPDNF
RSSDDEQNYENLETEVSLEEEAANLEERRKTFKEILSCLEMDRNRKLLPSFVQQFQLDHG
CHWIPQTSADLSWNFLVKIQCLDVTARDTVLSQRVPGEDVKEGLITKVENMGLRDKETIN
PLDVLCAIMLCSDNSLQQEVLGNMFKCHFALPLLLPDAENNKCLLMLDAMKNIVPKDSIH
SGGDAAEIDTKSLVFMKMPLISFVRLGYCGSSKSKILNTLLSTPQKQPLDIFHHRDSHAS
LLPRQISDGLVEITWSFPNSSSGKENLDFFQEPVAVANLRGDLECFWTQFGFLMEVSSAV
FIFIDCPGEREWDLLAFLGEAAKERCYFILSPQSRESEEAQLFQRILKLKPSQLLLLEEN
DMGDRGRYVEGLQIALKEVMCSPLRHVSVEDMASLARELGIQVDQDCEKAQGIQETLNEV
TAEVDEVEVPQRYTQPRNLPESQCHTATGRTRIFRGVSPQCHSFHHTTSFTPCPWAWCPP
LTRSKGNLYWAPMRPQWAMGSTMWPGFKPRWLGPLAFHNRRANIRGRNPGRWTGQPQRIH
QAAALVKSPRSPQVHHLSAAL
Download sequence
Identical sequences F7BFH7
ENSMODP00000025395 ENSMODP00000025395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]