SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025406 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025406
Domain Number 1 Region: 45-92
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 2 Region: 105-138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000028
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025406
Domain Number - Region: 519-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000424
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 271-325
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.00407
Family Heme-dependent catalases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025406   Gene: ENSMODG00000020310   Transcript: ENSMODT00000025857
Sequence length 561
Comment pep:novel chromosome:BROADO5:3:236051056:236131859:1 gene:ENSMODG00000020310 transcript:ENSMODT00000025857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDRRFALLIWLLEIILLVNGTKISLSETALNRPRREIETPAPIDCKLTSWSEWSSCEP
CQKEMYRSRTIEAFGQFGGKRCLHSLGDRRSCEPFRACDDEEYDCENDFKCETGRCIKKR
LLCNVDNDCGDFSDEDNCEKDPRSPCHTDVEMSELGRTAGYGMNILGMDPLDTPFDNEYF
HGLCERVRDGNTGTYYRKPWNVATLNYDTKAEKRLRTENYEEHVLQITDTFRERQKNFGF
DISLKLTSTEGPLSSLNAAASFDSNGGTPKRKPDPKRNQQDAGLTFRFRYSKNESLHLIK
YYASDKTKMFLQVKGEIQLGRFHMRNREFMLKSTFLDDLKALPTSYEKGEYFGFLETYGT
HYSSSGNIGGKYELIYVLDKEEMQRKGLEIQDVRKCLGLDLDLSYQSAVNFEANIKGSDC
SSVNWKRFDDNERKHIIDDVISLIEGGTREYATNLKEKLLRGPKVVDVTDFLNWSASLDN
APVLINQKLLPIGNLVPVRMENAHEKKQNLEQAINDYVDQFNSHKCQPCQNEGTTMLLDG
ECICACKTGFQGVACQISPVV
Download sequence
Identical sequences F7G7P1
ENSMODP00000025406 ENSMODP00000025406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]