SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025431 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025431
Domain Number 1 Region: 807-999
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-43
Family Laminin G-like module 0.00048
Further Details:      
 
Domain Number 2 Region: 380-582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.9e-40
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 601-808
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-39
Family Laminin G-like module 0.00088
Further Details:      
 
Domain Number 4 Region: 42-247
Classification Level Classification E-value
Superfamily Fibronectin type III 7.94e-34
Family Fibronectin type III 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025431   Gene: ENSMODG00000020329   Transcript: ENSMODT00000025882
Sequence length 1024
Comment pep:novel chromosome:BROADO5:3:237213731:237488276:-1 gene:ENSMODG00000020329 transcript:ENSMODT00000025882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLASGSRRGGSHLLSLLLLVFGFGPDAASSRAALRKEGRLGPPVDILLDSLNCSAFQVQ
WRMPHHHTNLITGYTVFYSEARENKFLHQMSQDVPLNEDILNMRPLDNQAAFEVVIGDLK
PGTTYRVSVRAYGWNTKGRPSSPQLVTTLSKDKCMPPSPPYQPQVIVVSDSEVALSWKPG
ESEGSSPIQYYSLEYIRPDFDNSWTLIKEQIQMDSMVLKGLLADTQYQFAVTAVNTFGAS
PRSQPSDTIQTFSTEEAGSGTSEPRYITDTGGSDDNGFDIDDSDFDIYIEEVKPLPAIKG
SHRKFLVETKMPPRSNPKSFSRRILPTSASPITTTPIHYTTTAKAKRRHGMAAMTRLFDM
SCDKTTCSADSFCVNDYNLGGSRCHCNLGKSGENCAEDISIQYPQFFGHSYLTLEPLKNS
YQAFQITLEFRAETEDGLLLYCGENEHGRGDFMSLAIIRRSLQFRFNCGTGVAIIISESK
IKLGSWHTVSIYRDGPNGLLQVNNGTPVTGQSQGQYSKITFRTPFYLGGAPSAYWLVRAT
GTNRGFKGCVQSLAINGKKIDMRPWPLGKTLSGADVGECSSGICDEASCINGGTCTAVKA
DSYICLCPLGFKGRHCEDAFTLAIPQFNQSLRSFAATPWPLEPQNYLSFMEFEITFRPDS
EDGVLLYSYDTGSKDFLSINMVAGYVEFRFDCGSGTAVLRSEEPLSLGHWHELHVSRTAK
NGILQVDRQRTVQGMAEGAFTQIKCNTDIFIGGVPNYDNVKKNSGILQPFSGSIQKIVLN
DRTIHVRHDFTSGVNVDNTAHPCVRAPCANGGSCRPRKDGYECDCPLGFDGQHCQKAITE
AIEIPQFIGRSYLIYNNPDILKRVSGSRSNAFMRFKTTAKDGLLMWRGNSPMRPNSDFFS
LGLQDGALVFSYNLGSGVASIVVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGKSPG
MMRQLNINGDLYVGGMKEIALHTNRQYMRGLVGCISHFTLSTDYHISLVEDAADGKNINT
CGAK
Download sequence
Identical sequences F7FWY4
ENSMODP00000025431 ENSMODP00000025431 XP_007487498.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]