SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025511 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025511
Domain Number 1 Region: 21-239
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.26e-64
Family Ankyrin repeat 0.0000996
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025511
Domain Number - Region: 612-642,729-938
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0706
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025511   Gene: ENSMODG00000020394   Transcript: ENSMODT00000025962
Sequence length 974
Comment pep:novel chromosome:BROADO5:3:241898305:242084207:-1 gene:ENSMODG00000020394 transcript:ENSMODT00000025962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLKAKFRKNDTNEWNKNDDRLLQAVENGDVEKVASLLGKKGACATKHDSEGKTAFHLA
ASRGHVECLRAMVTHGADVAAQDTAGHSALHLAAKNSHPECIKKLLQSKCPIESTDNSGK
TALHYAAAHGCLQAVQILCEHKSPVNLKDLDGNIPLLLAIQNGHTEVCRYLLDHGADVNS
RDKSGRTALMLSCETGNSNMAEALIKKGADINLVDSLGHNALHYSKLSENTGIQSLLLSK
ISQDPDVKTPTKPKQHDQVSKINSERSGTPKKRRAPPPPISPSQLSDLSTPRSVTSTPLS
GKEPVFFPEQPFKEEVSSLRDNKDRLSDSTAGADSLLDVSSEADQQDLLMLLQAKVASLT
LHNKELQDKLRARTPKEVEADLSTDSYHSTQTDLTPLVDKPNETSAFVLTHTLSKASSSS
DIKIQQLQEVLQDVQMKLDISEAERRELQAQLQFRVPESVCLNSSEISENGSDLSQKLKE
TQSKYEEAMKEVLNVQKQMKLGLVAPESKDNSYSDLHELRSTDEAIEALKQDLQNALEES
ERNKEKVRELEGKLEEKEKTVVIQPPVEEYEKIRNSYCSVIENMNQEKAFLIEKYKDAQE
EIKKLQDTLKSQAPQESSDETGDMKEAMNRMIDELNKQVTELSQLYKEAQAELEDYRKRK
SLEDVTSEYIHKDEHEKLIQVTNVSRMKAEDELSEMKSQYSKVLNEVTQLKQLVDAQKQN
SVSITEHLQVITTLRNAAKEMEEKISSLKKQLAGKETEVANLEKHLVEEKAAMNDAMVPR
ASYEKLQASLEGEVSALTSKLKDSVKEREKASLEVTQVRNEVSQIKREKDSIQNLLKAKE
QEVNELHQKCQQTQEELTEMRRYSENSSKLEEDKDKKINEMSKEVTKLKEALNSLSQLSY
TTSASKRQSQQLEALQQQVKQLQNQLTEAKKQHQEIVSVYRMHLLYAVQGQMDEDVQKVL
KQILTMCKNQSQKK
Download sequence
Identical sequences F7BZU9
XP_016287108.1.35504 ENSMODP00000025511 ENSMODP00000025511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]