SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025520 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025520
Domain Number 1 Region: 283-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-38
Family SPRY domain 0.00036
Further Details:      
 
Domain Number 2 Region: 13-83
Classification Level Classification E-value
Superfamily RING/U-box 1.72e-19
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 101-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000824
Family B-box zinc-binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025520   Gene: ENSMODG00000020399   Transcript: ENSMODT00000025971
Sequence length 464
Comment pep:novel chromosome:BROADO5:3:242451247:242452638:1 gene:ENSMODG00000020399 transcript:ENSMODT00000025971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGKNMASCSEFIQDFQEELICSICKDYFTNPMTIECGHTFCHSCLFSWENEASNSFFCP
ECKVVSQVRDFVANVRLGKLAGIAKKLRLQCFQNPERYSYQKEQKFFCENDQSLSCLSFS
ESQKHKAHALNCIDETTQDISKKLQETLTDLREKLKNVEQQMANEELKLAQFEEEMTIQK
GNISLEFQKLHVFLGEEEAECLSFVQRQEKANLEGLKKRIRRLSHQSQELSKRITEIDEE
CRKPDVDLLQNIKGTLNRNKYLLQEEIENFALRMIIYPIPGIIEMLLKFKIDITLNGNTA
SPGLIISEDLKSARYGGTQLEVLNENHTNFAKVCAVQYFISGRFYWEVEVPSNTEWGVGI
AKGQNLFEEFFVLMATQSQNGFKLYALGKCYVSSEPDVKYCFNCITQLVVGVFLDCEHRE
ISIYNVKERSLIFTFPTISFSGPFHPVFFLSTKVETNNSSLMIC
Download sequence
Identical sequences F7BZH3
13616.ENSMODP00000025520 ENSMODP00000025520 ENSMODP00000025520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]