SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025529 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025529
Domain Number 1 Region: 75-139
Classification Level Classification E-value
Superfamily ssDNA-binding transcriptional regulator domain 1.73e-23
Family Transcriptional coactivator PC4 C-terminal domain 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025529   Gene: ENSMODG00000020410   Transcript: ENSMODT00000025981
Sequence length 139
Comment pep:novel chromosome:BROADO5:3:244187499:244211330:-1 gene:ENSMODG00000020410 transcript:ENSMODT00000025981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKSKELVSSSSSGSDSDSEIDKKLPISSESILFPAKAKRKKQALPEKPIKKQKTGESSK
APASSKQSSSRDDHMFQIGKMRYVSVRDFKGKVLIDIREYWMDQEGEMKPGRKGISLNPE
QWSQLKEQISDIDDAVRKL
Download sequence
Identical sequences F7BZC8
ENSMODP00000025529 ENSMODP00000025529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]