SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025599 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000025599
Domain Number - Region: 233-305
Classification Level Classification E-value
Superfamily Prefoldin 0.00262
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025599   Gene: ENSMODG00000020457   Transcript: ENSMODT00000026051
Sequence length 338
Comment pep:novel chromosome:BROADO5:3:252261982:252320050:1 gene:ENSMODG00000020457 transcript:ENSMODT00000026051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLMTSEALQDMLTAEEDNLMLCKSKSAHISEETEYVRKLRTMLEDIRHQIFKDELDH
KIPQHTSCSKSCCCNTEYESEGKAKISPCGFNLIMEKMKDKDLQLQEMNKENEFLKIKLE
ASREAGAAALRSVAKKLFGDYEKQREELRKKHEDEKKLLQVNNFEKEKIYKQHVECLKQV
TERLGGKHCQIAKLENLVQKMEEEKKLLLEKKACLQFKLDQLLLNSKDAKSCKDLQTEIS
TLQRQISCLQFVIYSQHQNLRSVIQEMEGLKNDLQEQDKMIETLKEKVNVLEAQNKDLKN
KIKLWSECSKTKVSKGVCTSELMAEDTSPYLMLMRLRK
Download sequence
Identical sequences F7A2Y7
XP_007487619.1.35504 13616.ENSMODP00000025599 ENSMODP00000025599 ENSMODP00000025599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]