SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025675 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025675
Domain Number 1 Region: 847-927
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000224
Family DEATH domain, DD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025675   Gene: ENSMODG00000020520   Transcript: ENSMODT00000026132
Sequence length 946
Comment pep:novel chromosome:BROADO5:5:188504729:188620673:-1 gene:ENSMODG00000020520 transcript:ENSMODT00000026132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTEMDLPVGKLSQLLKQIWWQSQLINQTFLCSDLHDKDGEGAWVSTMILLCQELNGAL
CQHLEHVSGTLQVTCQQLHILLDKQKLCIWREEINALIDCLKKINEYLKSTVLHLQKTEK
DIVNLQAMNHEYISLHTQSTIQNTFSGTNISEKGKMDYIETAHDFSQPFPQISPPSKGES
HSMSQIQTQENKELMTSAYVEGENITLMNGNVMRQEMEFNEMSLENMAEKDCKQIEAADG
EKNNVKREEINATRSSKEFPREFQSNMESMSEEKRVSPMNDIANRYGENVLTNDSENLTQ
TNHVLEKAKPRISRVERRECIPEMGDKNEDGRWSIRYLVSPVNETGPKVACYITAPSSIL
QNLTCQIINDMSSLVVNDSEELVSNVISVEYSDHEKRIPFPISIAIPFSARYRGNYRDIM
VKVSDRDLQSSYINSSSLEGTRGSHKGTWAEVKVYKLGIFSVVSCLKKESFMVPKKGLSL
KLSMDPRISLSYPSGVFTSSVLVQLKVQPIDPSLLSTLKTKQDIYYSVVSTSPLIHLQQP
STHPFHKPVTIILPCSPNTERKTPGAEIEHKRASTATFRKITTSYHIRTKSASIRKPGDN
VSESLKLLGFRSREGSWFVLDDAVVRNVQSGIVSFELNEHLDRLLVIRLSSTMDNFHLVL
FAESLEEATFSTMACVVLYRNKENPHKAIVSLVPSKDLIQELKSLHKRGFSGPPEPSQFF
QMREGEQIILRFNGNIFASSNGKDYGKDYKLTFHLQRNPSLELQLKEVDEFGNYSSPYYK
GTVSVYKVPKDKLAKNLNEPLTLNDFGHQLPTCKLPLNLPKHEKLISHPQSTKRTSTDPS
EALWENLLYWLAEELSEENAASLAESLPLRRSTIQLVKLKNPDNLTEQIYEFLSFWKKSL
PTSVDKQRLLSRHLRKIGRRDLSEELRYRWENKVFSELQSWSDVEQ
Download sequence
Identical sequences F7ENS8
ENSMODP00000025675 ENSMODP00000025675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]