SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025712 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025712
Domain Number 1 Region: 40-474
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.41e-130
Family Family 1 of glycosyl hydrolase 0.0000000551
Further Details:      
 
Domain Number 2 Region: 490-887
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.62e-89
Family Family 1 of glycosyl hydrolase 0.00000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025712   Gene: ENSMODG00000020550   Transcript: ENSMODT00000026170
Sequence length 890
Comment pep:novel chromosome:BROADO5:5:185008518:185043721:-1 gene:ENSMODG00000020550 transcript:ENSMODT00000026170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIQELKGFAILWAFFFTGAVTGFPGEGQLLWKKDHNFNPMNETQMFLYDTFPKNFSWGV
GTGAFQVEGSWKKDGKGPSIWDHFISTHLKDVNSTDDSSDSYTFLEKDLSALEFLGVSFY
QFSISWPRLFPDGIVTIANEKGLQYYNALLDSLVHRNIKPVVTLYHWDLPLVLQEKYGGW
KNETIINIFNDYATYCFQTFGNRVKYWITIHNPYLVAWHGYRTGMHAPGEKGNTAAVYAV
GHNLIKAHAKVWHNYNTNFRPHQRGWLSITLGSHWIVPNKSENSLDVLKCHKSMTSVLGW
FANPIHGDGDYPEVMKESVSLLPHFSDAEKSQVRGTADFFAFSFGPNNFKPTSTVSKMGQ
NISLDLREVLKWIKLEYDNPKILITENGWFTDNHVTTEDTTAIYMMKNFLNKVLQAIKFD
KIRVFGYTAWSLLDGFEWQDAYTTRRGLFYVDFSSKQKERKPKSSAHYYKQIIKENGFIL
KESTPEVQGQFPCDFSWGITESVLKAESVASSPQFNDPHLYSWNISGNGQLLPVKGVTMK
TRAAQCTDFVSIKKQLKLLARMKITHYRFALDWSLILPNGDLSKINQQVLRYYKCVISEV
LKLNISSMVTLYYPTHAYLGLPAPLLQNGGWLNQSTVHAFRDYANLCFQELGDLVKLWIT
INEPNRLSDIYKASSNDTYRAAHNLLIAHALVWHVYDSRYRPSQHGAVSLSLHADWAEPA
NPYADSHLKAAERFLQFEIAWFSEPIFKTGDYPEAMKEYIAFKNKQGLSSSVLPRFTKEE
RKLIKGSADFYALNHFTTRLVIHEQQNGSQYDFDRDIQFLQDVTCLSSPTRLAVMPWGER
KILNWIQKNYGDVDVYITSNGIDDQSLENDELRKYYLEKYTQEALKGNPI
Download sequence
Identical sequences F7AQ46
ENSMODP00000025712 ENSMODP00000025712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]