SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025750 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025750
Domain Number 1 Region: 648-890
Classification Level Classification E-value
Superfamily vWA-like 3.89e-77
Family Trunk domain of Sec23/24 0.00000638
Further Details:      
 
Domain Number 2 Region: 419-614
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.4e-26
Family beta-sandwich domain of Sec23/24 0.0017
Further Details:      
 
Domain Number 3 Region: 992-1089
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.23e-24
Family Helical domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 4 Region: 1090-1238
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.33e-22
Family C-terminal, gelsolin-like domain of Sec23/24 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025750   Gene: ENSMODG00000020587   Transcript: ENSMODT00000026210
Sequence length 1239
Comment pep:novel chromosome:BROADO5:5:38281457:38373490:-1 gene:ENSMODG00000020587 transcript:ENSMODT00000026210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPAGAPHPHAAASARIPPRLGAAAAPAGPSPAPHYQNGPAQNQMQFPPGYGLHPQSYA
VPSGLYSQGPGKTAPLPLESQYGTDYYSGHYPVPTQNVVTLATGPGTMNMQLGSQQVYGR
GLPAPHTVGSTPGSFQGGIASSASHVHTGIPQPYSSFGNHYNSPVVPSANSSIASQGFPL
TSSHYAMSTALGAVYPNVSYPSVPAGDPYGQVFTSQSTSVITQFKENSFPGQNTAVNHPQ
QQQQSPMGYKTSSWATPGLQSTQDNLSQNHIGSLAAVGNPSNAVADSSSSPGKQSIQLSK
PSPAPSTVSSGSVSARTQPSADQSTDPVASGTQPPDLLLQEGMQYDDYVNNPASSAPTPS
GIACQLWKREGKENESSIDSSSTTSSASPVPNSFDVLEGGSYPGETLDALSSSTSSPAPA
PSIPQATKPTKPFGYGYPTLQPGYQNVALSSGAQPSNPTYSGFQQYALQYPGMHQLSSSL
SGLSLQHSSQQPESLRPVNLTQDRNILPGTPVQAPVPNLNSDLKKLNCNPDSFRCTLTNI
PQTQALLNKAKLPLGLLLHPFRDLTQLPVITSSTIVRCRSCRTYINPFVSFIDQRRWKCN
LCYRVNDVPEEFMYNPLTRSYGEPHKRPEVQNSTVEFIASSDYMLRPPQPAVYLFVLDVS
HNAVEAGYLTIVCQSLLENLDKLPGDSRTRIGFITFDSTVHFYNLQEGLSQPQMLIVSDI
DDIFLPTPDSLLVNLHESKELIKDLLNALPNMFTYTRETHSALGPALQAAFKLMSPTGGR
VSVFQTQLPSLGAGLLQSREDPNQRSSTKVVQHLGPATDFYKKLALDCSGQQTAVDLFLL
SSQYSDLASLACMSKYSAGCIYYYPSFHHTHNPSQAEKLQKDLKRYLTRKIGFEAVMRIR
CTKGKKKIELELLLLHIFIEMAYFMNVEEIQPQHIMWDERQGIREPLNETVLRMLCLIVP
CLYFTSLVLWELIIMNRWTTSLWLTSQLGNCLLHSLTVDRSISSSLSDARDALVNAVVDS
ISAYGTISSTSQQSALIAPTSLKLFPLYVLALLKQKAFRTGTSTRLDDRVFAMCQMKWQP
LVHLMKIIHPNLYRIDKLTDEGAIHVNDRIVPQPPLQKLSAEKLTREGAFLMDAGSVSPH
LFGHVNKTFFIDNVLGYPNYASVPQKLTHLPELDTLSSERTRSFLSWLRDNRPLSPVLHV
VKDESPGKTDFFQHLVEDRTEAAFSYYEFLLHVQQQICK
Download sequence
Identical sequences F7A0Q7
ENSMODP00000025750 ENSMODP00000025750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]