SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025774 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025774
Domain Number 1 Region: 133-620
Classification Level Classification E-value
Superfamily Cytochrome P450 2.49e-132
Family Cytochrome P450 0.00000000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025774   Gene: ENSMODG00000020607   Transcript: ENSMODT00000026235
Sequence length 620
Comment pep:novel chromosome:BROADO5:5:40209514:40243850:-1 gene:ENSMODG00000020607 transcript:ENSMODT00000026235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSRCSVYRHNGLGKRRIAAANQNARSEAASPLGLPPSFLHSAPRDDLQRRRREEGEGSN
LRRVEVINTREIGVSASMSSAVGAQAPVPEGSPGSPRLLLEPLGCALLLPPLLLLLLLAL
AWGLLLVRRRGVPPGPRPWPLVGNLGFMLLPAVFKRCIWSLLRLQRCAPRPRDPSRYSSQ
VVLEYLSRLYGPIFSFYLGPYLVVVLSDFHSVREALVQQGEVFSDRPRLPLISVFTKEKG
IVFAHYGPIWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKEEIQKHGGNPFSPFPII
SNAVSNIICSLCFGQRFEYNNSDFKKMLHLMSRGLEISVSYQMMLINICSWFYYLPFGLF
KEIRQIEKDLTVFLKGIIREHRETLDVENPQDFIDMYLLHMEEEMKSNSNTSFDEDYLFY
IIGDLFIAGTDTTTNTLLWCLLYMSLNPEVQEKVQKEIEKVIGPDRAPSLTDKVHMPYTE
ATIMEVQRMSAVVPFGIPRMTSEKTTLQGYTIPKGTMIIANLWAIHRDPAIWENPKNFSP
ERFLDEEGQLIKREHFIPFGIGKRVCMGEQLAKMELFLMFVSLMQNFIFTFPKDAKKPIM
PGKFGLTLSPHPFNVIVSKR
Download sequence
Identical sequences F6ZBI1
ENSMODP00000025774 XP_001366063.1.35504 ENSMODP00000025774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]