SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025857 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025857
Domain Number 1 Region: 304-671
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.31e-107
Family beta-glycanases 0.000000481
Further Details:      
 
Domain Number 2 Region: 38-192
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-43
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00065
Further Details:      
 
Domain Number 3 Region: 196-305
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000000000134
Family beta-Galactosidase/glucuronidase domain 0.0054
Further Details:      
 
Domain Number 4 Region: 677-776
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000388
Family beta-Galactosidase/glucuronidase domain 0.016
Further Details:      
 
Domain Number 5 Region: 1-42
Classification Level Classification E-value
Superfamily UBC-like 0.00000000522
Family UBC-related 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025857   Gene: ENSMODG00000020669   Transcript: ENSMODT00000026319
Sequence length 802
Comment pep:novel chromosome:BROADO5:5:47129508:47318420:1 gene:ENSMODG00000020669 transcript:ENSMODT00000026319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPDPYYRFNDLNYSWVSLDNWI
YSKEFRIPFDFRKWQKVNLIFEGVDTVAEVLLNNVTVGKTDNMFQRYTFDVTEEIRDMNT
IVLHFQSAVSYAAQQSKAHTGYQIPPECPEPVQKGVCHVNFIRKEQCSFSWDWGPSFPTQ
GIWKDVRIVAYDICQLDYLTFTPTYVSSAGEWNLKIEAYFDVVSSKPFGGQVTVSIPGLQ
TQQMYNIELHPGKSMIPLLMNINKSITVETWWPNGHGNQTGYNMTVNFKLEGGYHIEKLT
KVYFRTVELIEAPIAGSSGLSFYFKINGLPIFIKGSNWIPADSFQDRVTVDALRLLLQSA
VDANMNTLRVWGGGVYEQDEFYEICDELGLMIWQDFMFACALYPTDQAFVESVRAEAVHQ
IRRLKSHPSIIIWSGNNENEVALASNWFSVPPSKLQLYITDYVTLYVKNIREIVLAEDQT
RPFVTSSPTNGAESMAEGGVSQNPYDPHFGDVHFYDYASDCWNWKVFPKARFVSEYGFQS
WPSFSTLEKVSSPEDWSYNSSFSLHRQHHRDGNTEMLEQAAIHFKLPQNPDPLVMFKDTL
YLTQVMQAQCIKTETEFYRRSQSEIVDGKGHTMGALYWQLNDIWQAPSWASLEYGGKWKM
LHYFARHFFSPLLPVGFEDDGVFYIYGVSDLHKDYKMTLNVRVHQWSSLQPVCARRVEPL
VVKAGQAAPLYKEPMAELLRQCSPCTRQSCVVSFSLTAGNELSSPTNHHFLSSLKDAVGL
EKAKITHPQVISLRGDRKRENH
Download sequence
Identical sequences F7E5K0
ENSMODP00000025857 ENSMODP00000025857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]