SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025861 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025861
Domain Number 1 Region: 61-272
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.15e-82
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000208
Further Details:      
 
Domain Number 2 Region: 558-774
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.68e-59
Family Ankyrin repeat 0.0000194
Further Details:      
 
Domain Number 3 Region: 268-400
Classification Level Classification E-value
Superfamily E set domains 6.53e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000012
Further Details:      
 
Domain Number 4 Region: 824-906
Classification Level Classification E-value
Superfamily DEATH domain 3e-16
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025861   Gene: ENSMODG00000020672   Transcript: ENSMODT00000026323
Sequence length 995
Comment pep:novel chromosome:BROADO5:5:47344095:47513861:-1 gene:ENSMODG00000020672 transcript:ENSMODT00000026323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWEAAESSPSKGSRMVEEDPYILGMQDQIFPTESYGIGINAIFNSTGLFPAEIPLQTAD
GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLV
TNGKHVHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVYETLEARMTDA
CIRGYNPGLLVHPELNYLQPEGGGERQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFL
PDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDI
QIRFYEEEENGGFWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLE
TSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMYGGGGGGGGSASA
GPGYGFAPYGFSYAGIPFHPGTTKSNAGMKHGTLDSSSVQGHAGCDESDDRSSAELSGKI
LKTTEQDDKPRVTGRDEITLTCTVVEEEDCRLQGDPFLEKAMQLAKRHASALFDYAVTGD
VKVLLAVQRHLTAVQDDNGDNVLHLAIIHLHAELVRNLLEVISGLLSDDIINMRNDLYQT
PLHLAVITKQEDVVEDLLRAGADVSLLDRLGNSALHLAAKEGDDKILNILLKHKKILPLI
DHPNGEGLNAIHLAMLINSMPCLRLMIAAGADVNAQEQTSGRTALHLAVEQENVSLAGCL
LLEGDAFVDSTTYDGTTPLHIAAGRGSTKLAALLKAAGADPLLENFEPLYDLDDVWDQDG
EDEGVVPGTTPLDMAANSQVYDILNGKPYQSESTSSDLLAQGDMKQLDEEAKLQLYKLLE
MPDPDKNWSTLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIRELVDALRQMGYTEA
IEVIQKAFSASVNPSEIKEQPTEQIYSLPPSPSCIRQQLGDICKLQDNESVCDSGVETSF
RKLSFTESLTSTGALITLNKMPCDYGQETSIEGKV
Download sequence
Identical sequences F7DLB9
ENSMODP00000025861 XP_007495939.1.35504 ENSMODP00000025861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]