SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025883 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025883
Domain Number 1 Region: 691-803
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000471
Family Myosin rod fragments 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025883
Domain Number - Region: 737-974
Classification Level Classification E-value
Superfamily Tropomyosin 0.00177
Family Tropomyosin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025883   Gene: ENSMODG00000020689   Transcript: ENSMODT00000026345
Sequence length 1113
Comment pep:novel chromosome:BROADO5:5:169737235:169860266:-1 gene:ENSMODG00000020689 transcript:ENSMODT00000026345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAAERKFINIRKRLDQMGYRQPLSVDCLPLVEKLFSDLVHTTESLRKTKLYVGKAEKE
SANFDYVLEPYKKENAKLTRENNELHLDLLRTKEQSEISIKDLKVKLRKMEIETADLKFL
NNQYAHKFRVLEKESKAKNEKIQQLQEKNLQAVVQTPGGKKRSIPFRRQRMQIDQPVPPS
GISTYPVPQPNDPYIADLLQVADNRILELQEEVCHLQKKLVSAENELENSCKQIELRDLE
IERLSVALDGGRSHDVLSLESRNQSNEKLITHLNIQIDFLQQTNRDLENRIQELLDSKKT
VTNEVITLNSKNEKLFRRLDEIDHRAHHMERHREEVLETTDKQLTEAQVEIKRLHCEMHS
LEETIANLKMELNLCHKEKARLTDELVIKTDLETIINQIEHEKNRLARKVERFANSEREL
VLEVERMRKDYCATRRKKSPSRLDVFLRSVEEERDHYKKELERLQKIIKRRSIPMRSSRC
ERSLSVTCPEKGAYISELCLITKERDELQSLLDKFENHMGEIQCNVKLLTAERDKLSDLY
SQAQHDLCTLRKEASYSLPPQEILCLMEQEKETALTDLRLTIVEKEALREKLKNLQELAF
VGKTEMEKNLEDLENINYELETERCDLKTKVSVMRETIESLENKLKAQYHKLIHVADDSS
QQKTALNSLRIINEQLQRAVDDFQHRCAIKNEEQQAAEIQIASLEEKIGRLTCKITSQDE
EIVALKNTICVIDKEKDYLQEAVDEKTEKVVSLEDIIANKEKTISHLQVTIAEVESTIGQ
LQDLLSNRERDVSSLQRQLEETRLELSEVIRAREIALKENRRLQDDLGTMTRENQAVSLE
LEQAIHEKEELKKRVHDYITEVSRCETIMAAKEQENQDLLEKFQMLHSRAEDLKIKAHHA
EGESTSIRLELLSVDTDRRHLRERVELLEKEIQEHINAHRAYETQISSMTKALSRLEEKL
RCEHDEKASILTDLSSLRELCIKLDSGKEFIARQLVSKNMEYERALEEVETAKTEAEVLK
QQLSSERVTVDNLETLLATNRDKEFHSHITSHEKESEILRLQDMLAISENQLASHIRESN
VLRAKITQMQADNDVLKMQLATEQFERVVVFKE
Download sequence
Identical sequences F7DKG9
ENSMODP00000025883 ENSMODP00000025883 XP_007496489.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]