SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025994 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025994
Domain Number 1 Region: 2710-2998
Classification Level Classification E-value
Superfamily BEACH domain 2.22e-125
Family BEACH domain 0.0000000183
Further Details:      
 
Domain Number 2 Region: 3069-3268,3431-3463
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.7e-31
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 2556-2678
Classification Level Classification E-value
Superfamily PH domain-like 5.41e-23
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3471-3537
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.78e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 492-536,601-679,869-928
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000959
Family Armadillo repeat 0.037
Further Details:      
 
Domain Number 6 Region: 1111-1271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000655
Family Trypanosoma sialidase, C-terminal domain 0.078
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025994
Domain Number - Region: 2366-2425
Classification Level Classification E-value
Superfamily Cyclin-like 0.000241
Family Retinoblastoma tumor suppressor domains 0.01
Further Details:      
 
Domain Number - Region: 1431-1482,1534-1600,1635-1725
Classification Level Classification E-value
Superfamily ARM repeat 0.000525
Family HspBP1 domain 0.048
Further Details:      
 
Domain Number - Region: 213-325,356-371,469-535
Classification Level Classification E-value
Superfamily ARM repeat 0.0207
Family Mo25 protein 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025994   Gene: ENSMODG00000020782   Transcript: ENSMODT00000026459
Sequence length 3548
Comment pep:novel chromosome:BROADO5:5:56954328:57239771:-1 gene:ENSMODG00000020782 transcript:ENSMODT00000026459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHKLRRRRTSQDSGDSYKQAKMNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHP
PRHMTQKEQEEKLYMMLPVFNRVFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASN
KSTEAASRAIVQFLEINQSEEASRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLY
LFFDLPHVPEVVGGAQNELPLAERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFS
AITSWCPPYNLPWRKSAGEVLMTISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLE
IVEMFAGLSCFLKDSSDVSQTLLDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNL
ITSLTTYGVSELKPAGITTGAPFLLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTNY
LPQIILDAITNIYIADNANYFILESQHTLSQFAEKISKLPEVQTKYFEMLEFVVFSLNYI
PCKELISVSILLKSSSSYQCSIIATKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAA
FLKDPQALNEQGDSKNNSSVEDQKQLALLVMETLTILLQGSNTNAGIFREFGGARCAHNI
VKYPQCRQHALMIIQQLVLSPSGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESH
RTRTVFRKVGGFVYITSLLVAMERSLSCPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYE
PANSHFFKTEIQYEKLADAVRFLGCFSDLRKISPLNVFPSNTQPFQRLLEDDLTSVDSVS
PTLRHCSKLFIYLYKVATDSFESHAEQIPPCLTNESSLPSPWGTPAVSRKRHAYHSVSTP
SGYSSKNVADLKQQPAAPSLQSSDAVVIHPGAMLAMLDLLSSVGSPSQPEHALDLQLAVA
NILQSLVHTERNQQVMCEAGLHARLLQRCSAALADEDHSLHPPLQRMFERLASQALEPVV
LREFLRLANPLNCGAWDKNLLKQYRIHKPSSLSYEPEMRGSMVTSIEGLGSDNVFSLHED
NHYRISKSLVKSAEGSTVPLTRVKCLVSMTTPHDIRLHGSAVTPAFVEFDTSLEGFGCLF
LPSLAPHNAPTNNAATAGLTDGTVISGIGSGERFFPPPSGLSYSSWFCIEHFSSSPNHHP
VRLLTLVRRANSSEQHYVCLAIVLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCC
ARFRCGDLIVEGQWHHLVLVMSKGMLKNSTAALYIDGQLVSTVKLHYIHSTPGGSGSANP
PVVSTVYAYIGTPPAQRQLASLVWRLGPTHFLEEVLPISSVNIIYELGPNYVGSFQAVHV
PCKDSKSESGIQSPVSLVPEEKVSFGLYALSVSSLTVAKIRKVYNKLDSKAIAKQLAISS
HENATPVKLLHNSAGHLNGPARTVGAALIGYLGVRTFIPKPVATTLQYIGGAAAILGLVA
MASDVEGLYAAVKALVCVVKSNPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSL
VGTVDSGHETSIIPNSTAFQDLLCDFEVWLHAPYELHLSLFEHFIELLTESSEASKNAKL
MREFQLIPKLLLTLRDMSLSQPTIVAISNVLSFLLQGFPNSNDLLRFGQFIASTLPTFAV
CEKFVVMEINNEEKLDTGTEEDFGVLVSANLILLRNRLLDILLKLIYSSKEKTSINIQAC
EDLVRTLGFDWLLMFTEEHLHSTTVTAAMRILVVLLSNQSVLIKFKEGLSGGGWLEQTDS
VLTNKIGTVLGFNVGRSAGGRSAIREINRDACHFPGFPVLQSFLPKHTNVPALYFLLMAL
FLQQPVTELPENLQVSVPVISSRCNQGCQFDLDSIWTFIFGVPASSGPVVSSIHNVCTEA
AFLLLGMLRSMLNSPWQSEEEGSWLREYPVTLMQFFRYLYHNVPDLASMWMSPEFLCALA
ATVFPFNIRPYSEMVTDLDDEVGSPAEEFKAFAVDTGMNRSQSEYCNVGSKTYLTNHPAK
KFVFDFMRVLIIDNLCLTPASKQTPLIDLLLEASPERSTRTQQKEFQTYVLDSVMDHLLA
ADVLLGEDASLPITSGGSYQVLVNNVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQS
KRRSQGLSLDAVYHCLNRTILYQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQE
FISCLAHCLINLHVGSHVDGFGLEAEARMTTWHIMIPSDIDPDSSCSQDVSEGRQLLIKA
VNRVWTELIHSKKQTLEELFKVTLPVNDRGLVDITIARPLIEEAALKCWQNHLAHEKKCI
SRGEALVPSTQSKLSRVSSGFGLSKLTGSRRNRKESGLNKHNLSMQEISQWMFTHIAVVR
DLVDTQYKEYQERQQNALKYVTEEWCQIEYELLRERGLWGPPIGSHLDKWMLEMTEGPCR
MRKKMVRNDMFYNHYPYMPETEQETNVLSATPSKQLDPPDDTIPQKKPARYRRAVSYDSK
EYYMRLASGNPAFVQDAIIESSEGESTQQEPEHGEDTIAKVKGLVKPPLKRSRSAPDGGD
EENQEQLQDQIAEDSSREEEEKTDNATLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFG
KEHFYVIDGFTMTATREIRDIETLPPNMHEPIIPRGARQGPSQLRRSCSIFAYEDIKEVH
KRRYLLQPIAVEVFSGDGRNYLLAFQKGVRNKVYQRFLAVVPSLTDSSESVSGQRPNTSV
EQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWVLADYDS
QEVDLANPKTFRNLAKPMGAQTDERLTQYKKRYRDWEDPNGETPAYHYGTHYSSAMIVAS
YLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLL
NSNNFDLGCKQNGTKLGNVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYK
QQGPAAVDAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRV
RSRLNGDNSGLSVPPGPTSDKIFFHHLDNLRPSLAPVKELKEPVGQIVCTDKGILAVEQN
KVLIPPTWNKTFAWGYADLSCRLGTYESDKAVTVYECLSEWGQILCAICPSPKLVITGGT
STVVCVWEMGTSKEKAKTLTLKQALLGHTDTVTCSTASLAYHIIVSGSRDRTCIIWDLNK
LSFLTQLRGHRAPVSALCINELTGDIVSCAGTYIHVWSINGNPVVSVNTFTGRSQQIVCC
CMSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPETPAPEPIEDLEMQEDCPEAQIGQEG
QDEESSDSEAEESSIIQDPKETPSQPGSVSHRPRAASCRAAAVWSADSGSDDSRRWSDQL
SLDEKDGFIFVNYSEGQPRVHLQGPLNHPHPYPVDVRHYNSLKPGYRWERQLVFRSKLTM
HTAFDRKDNAHPAEITALGISKDHSRILVGDSRGRVFSWSVSDQPGRSAADHWVKDEGGD
SCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHERY
PEDGPKNC
Download sequence
Identical sequences F6YKJ3
ENSMODP00000025994 ENSMODP00000025994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]