SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026097 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000026097
Domain Number - Region: 43-90
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0759
Family Myosin rod fragments 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026097   Gene: ENSMODG00000020870   Transcript: ENSMODT00000026562
Sequence length 440
Comment pep:novel chromosome:BROADO5:Un:32535623:32604348:1 gene:ENSMODG00000020870 transcript:ENSMODT00000026562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLVKRNIEPRHLCRGALPDGVTSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFNEAN
SFYMRMNSLQERVDLLVIKVTQLDSTVEEVSLQDINMRKAFRSSTIQNQQVVSRNSIPNP
VMEMYQRCDKPPPLNILTAYRDDKKDGLKFYTDPSYFFNLWKEKMLQATEDKRKEKRRQK
EQRLVEDSTREVKKVRKARNRRMEWSMMAYDKEFRPDNRFSPSPYHMASSEGSLSPDNRS
YASDIGDHSYPASPNHPAQQVLAPAPHLPMEHKEIILAPSQLPELAYRPTAPGSRQNSLG
RVQQPHVPQPPDPILNGPRPQLIKDYGSQQVPMADFFVPPAPPPPPPVIPSAQTAFDSPI
SAPPALAPAAAATLAHPSYTPSPPPAPPCPYSVSPPQTGPMGPPAAPPPPPPGPPMATAS
PAHSASPGAVLSDHGNLRSH
Download sequence
Identical sequences H9H7N8
XP_007506211.1.35504 XP_016282683.1.35504 XP_016282684.1.35504 ENSMODP00000026097 ENSMODP00000026097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]