SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026115 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026115
Domain Number 1 Region: 12-432
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.05e-82
Family L-arabinose binding protein-like 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026115
Domain Number - Region: 439-485
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00577
Family TNF receptor-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026115   Gene: ENSMODG00000020886   Transcript: ENSMODT00000026580
Sequence length 786
Comment pep:novel chromosome:BROADO5:Un:30000541:30010080:-1 gene:ENSMODG00000020886 transcript:ENSMODT00000026580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFSLVPILSYETKVLGYNLMQAMRFAVEEINNDSSLLPGLLLGYEMVDVCYLTNNIQPVL
YFLAKENFSLPIQQDYSNYLPRVVAVIGPDTAESVVTVNHLLSLFLLPQITYSAISNELR
DRSRFPSLFRTIPSGSHQMEAMIRIIIHFHWNWVILLVSSDDYGRENGHLFSEKLEGRDI
CVAFQESLPIPSPNRVVMPQDKRRMEGLVAKIRRSTAKVVVVLSLDLALYTFFEEVLRQN
LTGTVWIASESWSIDPVLHSFFSVRRAGTFLGITTPIVPIPGFSDFRIRRSEVRKPAMDG
KHPQPTCNQECDTCPDAAESYNTVLTLSGERVVYNVYLSVYIVAHALHSLLDCEAARCSR
DEVYPWKLLQEIWKVNFTLLDRRIFFDEQGDLPLGLEIIQWQWEDGHNPFNSIAFYNPAE
QRLFVATNISWHTANNTAPSSVCSKSCQPGQWKRPVGLHPCCFECVDCAPGTYHNLSEDF
ECQHCPLNEWSNAGAIQCYKRRLQYLEWQEPLTIIVVILATLGFLSTLAILIIFWVHFQT
PMVRSAGGRMCFLMLTPLLVAYVSVPVYIGRPTVFTCLYRQTLFTLCFTVCIACINVRSF
QIVCIFKMASQLPHAYSYWVKYNGPYVFVVLITLLKVGIVVSSAMAIPTSPTILYDNENP
QIMILNCNINSRKAILFNTSLDLILSIFGFSFSYMGKELPTNYNEAKFITLSMTFYFASS
AFLCTFMSVYQGVLLTIFDVSITVINLLSISMGYFGPKCYMILFYPQRNTLAYFNNVIQG
YTMRKE
Download sequence
Identical sequences H9H7P8
ENSMODP00000026115 ENSMODP00000026115 13616.ENSMODP00000026115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]