SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026185 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026185
Domain Number 1 Region: 332-409
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.71e-20
Family Intermediate filament protein, coiled coil region 0.00067
Further Details:      
 
Domain Number 2 Region: 101-135
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000162
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 144-210
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000785
Family Intermediate filament protein, coiled coil region 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026185
Domain Number - Region: 232-332
Classification Level Classification E-value
Superfamily Prefoldin 0.000549
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026185   Gene: ENSMODG00000020935   Transcript: ENSMODT00000026650
Sequence length 490
Comment pep:novel chromosome:BROADO5:Un:26618413:26720559:1 gene:ENSMODG00000020935 transcript:ENSMODT00000026650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVQFSAQTFSSRSAAFPRRGAQGLLSSGASRGGSASHMGAFGSSSLYGLGSGRPRVSVG
FRSGGGFGVKGAGIHEVTINQSLLAPLNVEIDPQIQQVRKEEREQIKTLNNKFASFIDKV
RFLEQQNKMLETKWSLLQEQKSSKGSSLPSIFEAHIANLRRQLDGLQGDRGRLESELKNM
QDVVEDFKTKYEDEINKRTAAENEFVMLKKDVDSAYMTKVELDAKVDALMDEINFLRTLY
EMELNELQNQISDTSVVISMDNRRNLDLDSIIDEVKAQYEDIANRSRAEAESWYQTKCEE
MKATVIRHGESLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVTQSEQQGEAALND
ARCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYKRLLEGEEQRLCEGVGA
VNVCVSSSRGGVVCGDLCTSTSGARVVSTGSTGPSGGSVVVSAPNACAPCGVGSGYSTRS
CATSCGVRRC
Download sequence
Identical sequences H9H7S9
ENSMODP00000026185 ENSMODP00000026185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]