SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026187 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026187
Domain Number 1 Region: 340-417
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.74e-20
Family Intermediate filament protein, coiled coil region 0.00069
Further Details:      
 
Domain Number 2 Region: 110-144
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000141
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 3 Region: 14-106,427-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000282
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026187
Domain Number - Region: 227-340
Classification Level Classification E-value
Superfamily Prefoldin 0.000149
Family Prefoldin 0.01
Further Details:      
 
Domain Number - Region: 147-218
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000387
Family Intermediate filament protein, coiled coil region 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026187   Gene: ENSMODG00000020936   Transcript: ENSMODT00000026652
Sequence length 486
Comment pep:novel chromosome:BROADO5:Un:26739214:26748834:-1 gene:ENSMODG00000020936 transcript:ENSMODT00000026652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGISTVGCGIRPRNFGCFSAYVPRMGDRCCVSAAPYRGVSCYRGLTGFGSRSICGGYR
AGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKHEEKEQIKCLNS
KFAAFIDKVRFLEQQNKLLETKWQFYQNRKCCESNLEPLFQGYIETLKRELDCVEADSGR
LSSELNHVQEVLEGYKKKYEEEVTLRATAENEFVVLKKEVDCAYLRKSDLEANAEALTEE
INFLRALYEEELRVLQTHISDTSVVVKMDNSRELNMDCVIAEIKAQYDDIASRSRAEAES
WYRSKCEEMKATVIRHGESLRRTKEEINELNRMIQRLTAEVENAKCQNCKLEAAVTQSEQ
QGEAALSDARCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYKRLLEGEEY
RLCEGVGAVNVCVSSSRGGVTCGDLCQSGSRPVTGSVCSAPCNGNLVVSTGCCAPCGSLS
TSCGRC
Download sequence
Identical sequences H9H7T1
ENSMODP00000026187 ENSMODP00000026187 XP_001377320.1.35504 13616.ENSMODP00000026187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]