SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026288 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026288
Domain Number 1 Region: 222-472
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.48e-90
Family Eukaryotic proteases 0.0000612
Further Details:      
 
Domain Number 2 Region: 128-234
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-16
Family Hepsin, N-terminal domain 0.042
Further Details:      
 
Domain Number 3 Region: 93-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026288   Gene: ENSMODG00000021020   Transcript: ENSMODT00000026756
Sequence length 477
Comment pep:novel chromosome:BROADO5:4:8488913:8542629:-1 gene:ENSMODG00000021020 transcript:ENSMODT00000026756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFEKEVEVELEANQGGSEGVTATNPDLSTSEAPFSFRSFFGFDDLKMGPGEIGPDADAL
AAQILSLLPLKFFPIIVIGIIALIIAVAIGLGIHFNCSGKYRCRSSFQCIDLTARCDGVF
NCKDGEDEYRCVRVSGRNAVLQVFVDAAWRTMCSDDWKGQYGLIACEQLGFSSYISSRTM
RLESVEEELQEEFVSMNHLIPENKVTSLHHAVYVRENCASGRVVILKCTTCGLRIGYSPR
IVGGNMSSLMQWPWQVSLQFQGYHLCGGSLITPVWIVTAAHCVYDLYMPSSWTIQVGLVT
LIDTPAPSYSVDKIIYHSKYKPKRLGNDIALMKLAVPLTFNDMIQPICLPNSEEDFPDGK
MCWTSGWGATEEGGDASTVLNHAAVPLISNKICNHKDVYGGIIAPSMVCAGYLQGGVDSC
QGDSGGPLVCEERKIWKLVGATSFGIGCADVNKPGVYTRITSFLDWIHEQMEVGISL
Download sequence
Identical sequences F6QZA7
13616.ENSMODP00000026288 ENSMODP00000026288 ENSMODP00000026288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]