SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026360 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026360
Domain Number 1 Region: 43-265
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.58e-55
Family DJ-1/PfpI 0.00000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026360   Gene: ENSMODG00000021082   Transcript: ENSMODT00000026829
Sequence length 268
Comment pep:novel chromosome:BROADO5:4:16412623:16440654:1 gene:ENSMODG00000021082 transcript:ENSMODT00000026829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAVRFAAASRPVLPVCLPWLRSGGRHHTPVAGFHGSALRPGAKVAVIFSGCGVYDGTEI
HEASAILVHLSREGAEVKMYAPNVPQMHVIDHTKGQPTESEKRNALVESARIARGKIAEL
SELKSKDFDAVIFPGGFGAAKNLCTFAVDGKDCKVDKDVERILNEFHKEGKPIGLCCISP
VLAAKVLKGTEVTVGHEQAEGGKWPYCETAEAIKALGAKHCVKEVTEAHVDSKNKVVTTP
AFMCETGLHHIFDGIGIMVHNVLKLTRK
Download sequence
Identical sequences F6UJ27
XP_001377647.1.35504 ENSMODP00000026360 ENSMODP00000026360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]