SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026432 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000026432
Domain Number - Region: 12-98
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00693
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number - Region: 174-209
Classification Level Classification E-value
Superfamily RbcX-like 0.0549
Family RbcX-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026432   Gene: ENSMODG00000021147   Transcript: ENSMODT00000026903
Sequence length 403
Comment pep:novel chromosome:BROADO5:Un:31625625:31645319:-1 gene:ENSMODG00000021147 transcript:ENSMODT00000026903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGAKEAPSAVEVMQETLSGRLITVERSNAALAAEKAALQGQLRQLEGQVGTLQGRAQEVA
LQGERERLAQDRLHQKGLEEELRRLQSEHERAQVSLADASRERGELQGERGELRGRLARL
ELERAQLEAQGQGLREANQRLDLSVCQLTTQCQLLTELRAAQEEENRQLLAEVQALSREN
RGLMERSLESRDHLHREQREYLDQLNALRREKQKLVEKIMDQYRVLEPGPLPRTKKGSWL
ADKVKKLMRHRREGGLQGGPRPGIEGAGSLESLGGPLDLELPEGREANEAGTFDPGRPMR
RAQSSLCLREETSSSGQRRRLSSRFPVVRGSESFSPGDSPRQRFRQRRPGPLGSPDLPFQ
TSLSPSGWDGSADILEGPEAVADQEGPVEQEPKKAPLTPSLSQ
Download sequence
Identical sequences H9H7V5
ENSMODP00000026432 13616.ENSMODP00000026432 ENSMODP00000026432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]