SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026444 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026444
Domain Number 1 Region: 25-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-37
Family SPRY domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026444   Gene: ENSMODG00000021155   Transcript: ENSMODT00000026915
Sequence length 204
Comment pep:novel chromosome:BROADO5:8:31311958:31313246:1 gene:ENSMODG00000021155 transcript:ENSMODT00000026915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPLTRVLRREAVWLGAAGTATRRAISFKLEEKTAHSSLALFKEETGVKYGLVGLEPTK
VALNVERFRDWAVVLGDTRVTTGQHYWEVTVKKSKHFRIGVADVDIPRDGCIGVDSHSWV
FAYAHQKWHAMLAKESFPITGIGHPEKVGLLLNYEAQRLSLVDISRTAVVYTLRTEFHGP
VVPAFALWDGQLLTHSGLDVPEGM
Download sequence
Identical sequences F6QBR8
XP_007503011.1.35504 ENSMODP00000026444 ENSMODP00000026444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]