SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026528 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026528
Domain Number 1 Region: 360-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000489
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 2 Region: 440-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 403-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000482
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 479-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family EGF-type module 0.02
Further Details:      
 
Domain Number 5 Region: 105-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 324-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000339
Family EGF-type module 0.033
Further Details:      
 
Domain Number 7 Region: 54-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000552
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026528
Domain Number - Region: 511-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000329
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026528   Gene: ENSMODG00000021223   Transcript: ENSMODT00000027003
Sequence length 547
Comment pep:novel chromosome:BROADO5:7:219145170:219577300:1 gene:ENSMODG00000021223 transcript:ENSMODT00000027003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSRRPRRRRLLPPLPTNPLPVGRPLLPGLLLLLLSPGPSQSLPVTPAVPLPDPCALQP
CRNNGTCSPSASSSPSPGQQQPDFQEPPDLGYSCTCPAGVTGSNCQFVADPCASNPCLHG
NCSTSEDGYLCICDEGYKGISCEQASPSLPVSSWTESPAPRQLQPVSSTQEPDVVLPPSQ
ATVTLPTWQPKEGQKVVNMKWDEIEIIPDIACGNASSNNSSGGRLVSFEVPQNTSVKIWK
DATASLILLWKVTATGFKQCSLIDGRSVTLLQALGGLVLSEEMLVLGNNYFIGFVNDSVS
KCIVALRLTVVVKVSTCVPVDSKSHDVQCSEKGKCTTTPAEATFSCKCEDQYVGTFCEEF
DACQVQPCQNNGSCVDAIEKHDGNNFTCVCQPGYTGELCQSLVDYCILEPCKNGATCNSD
LSGFSCQCPEEYSGPSCEEKVDPCASSPCQNNGTCYADRAHFTCSCSAGFTGSTCAQLID
FCALNPCAHGTCRSVGTSYKCLCDPGAYGSHCELYKDPCANISCLNGGTCDSESLNGTCI
CLPGFTG
Download sequence
Identical sequences F6U1A2
ENSMODP00000026528 ENSMODP00000026528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]