SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026684 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026684
Domain Number 1 Region: 353-489
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.91e-38
Family Gelsolin-like 0.0000619
Further Details:      
 
Domain Number 2 Region: 209-401
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.14e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.011
Further Details:      
 
Domain Number 3 Region: 579-696
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.28e-32
Family Gelsolin-like 0.0000303
Further Details:      
 
Domain Number 4 Region: 24-111
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.34e-26
Family Gelsolin-like 0.0000779
Further Details:      
 
Domain Number 5 Region: 474-573
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.74e-25
Family Gelsolin-like 0.0003
Further Details:      
 
Domain Number 6 Region: 723-787
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.2e-23
Family VHP, Villin headpiece domain 0.00014
Further Details:      
 
Domain Number 7 Region: 88-193
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.02e-20
Family C-terminal, gelsolin-like domain of Sec23/24 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026684   Gene: ENSMODG00000021352   Transcript: ENSMODT00000027163
Sequence length 787
Comment pep:novel chromosome:BROADO5:Un:32068889:32089007:-1 gene:ENSMODG00000021352 transcript:ENSMODT00000027163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARLSHPPAAPCLQTRSSGSLLSQDIHYWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQ
HREVQHHESDTFRGYFKQGIIYKKGGVASGMSHVEPNAYRVKRLLHVKGKRRVAATEVDL
TWDSFNLGDVFLLDLGRVIIQWNGPESNTGERLKAMLLAKDIRDRERGGRAEIGVIEGDD
EAASADLMKVLLDTLGERSQIVSATSDELLDQEQKSNITLYHVSDFAGQLKVAEVSTRPL
VQDLLNHDDCYILDHGGSKIYVWKGRGATKTEKQTAMSKALGFIQMKGYPSSTNVETVND
GAESAMFKQLFQKWTVKDQTSGLGKSFSMNKIAKVIQDKFDVTLLHTKPDVAAQERMVDD
GSGNVEVWRIENLELVPVEDRWQGFFYGGDCYLVLYTYHVNAQPRYILYIWQGRHASKDE
LAASAYQAVELDRQYGGAPVQVLVSMGKEPGHFMAIFQGKLVIFEGGTSRKASAEPDPPV
RLFQIRGNDKSNTKAVEVPAFASSLNSNDVFLLQTQNEHYLWYGKGSSGDERTMAKELAG
VLCDGTEDTVAEGQEPEAFWDSLGGKVPYANDKRLQQEVIDVQPRLFECSNKTGRFVVTE
IIDFTQDDLNPGDVMLLDTWDQVFLWIGAQANAVEKEGAFASAREYLHTHPSGRDTDTPI
LITKQGFEPPVFTGWFLAWDPHSWSEGTSYEQLKEELGDPAEIVKIAADMHRAPLLLSAA
DGEQKYYPLEVLLKNQDQELPGDVDPAKKENYLSDEDFVAVFGITREKFAALPVWKQLNL
KKEKGLF
Download sequence
Identical sequences H9H7Z4
ENSMODP00000026684 ENSMODP00000026684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]