SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026737 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000026737
Domain Number - Region: 406-503
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026737   Gene: ENSMODG00000021401   Transcript: ENSMODT00000027218
Sequence length 510
Comment pep:novel chromosome:BROADO5:3:292021967:292466393:1 gene:ENSMODG00000021401 transcript:ENSMODT00000027218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLDSIHKLIEETQIFKLQQSPLRSPCEPAVPALSLHEPCNSYFPPQGLHSHGAQNFYAH
SYRGNDWDICEELRVRELEEVKARAAQMEKTMRWWSDCTANWREKWSKVRIERNKAREEG
RQLRIRLEMTMKELSALKKKQSSQNEKETLDTKNIWKEKPSLLEVSCSQDAQFPMASQEY
DPNKVNLGKTYVSIKENINKKEIEMVANTVKFNQDLDLQCPDFFIKGISGTCVTKPTPRL
DNVAQSLGKELTQISTLKFDLDESQKTLWKEREMRSSLEKEVELLESALSLWKCKYEEIN
ESKQMTLNQFNIFHDRHGNEVQKVSEEREDEANCQTSKDRVICELRAELERLQAENTSEW
GKREILETEKQSLERDNRRLKAQVKEMEELLDRKNPLTATSQCPDLKTSQSELLEKKKEL
AELQHAYSKLNKQYQDKMAELIHANHRVDHHEVEVKKLRFRVEDLKKGLNHAEDELDDSL
NQIRKLQQSLEQQVEMNDNLQIQLNHLQSR
Download sequence
Identical sequences F7CVH4
13616.ENSMODP00000026737 ENSMODP00000026737 ENSMODP00000026737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]