SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026744 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026744
Domain Number 1 Region: 141-248
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 358-473
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-23
Family Cadherin 0.0087
Further Details:      
 
Domain Number 3 Region: 249-344
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-18
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 462-571
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-17
Family Cadherin 0.0037
Further Details:      
 
Domain Number 5 Region: 75-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000002
Family Cadherin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026744   Gene: ENSMODG00000021408   Transcript: ENSMODT00000027225
Sequence length 771
Comment pep:novel chromosome:BROADO5:3:287566796:287745683:-1 gene:ENSMODG00000021408 transcript:ENSMODT00000027225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCYVSLQFLLGLAQLCPCHTDMTNSKMHEMNQSLEFHLRAKRSWVWNRFFVQEELSGIE
LHVGRLRSNLDNGDASLIYVLSGEGAGSIFTINNRTGDITAIKKLDREEKSYYKLRGQVI
DVVTGKPVEPESEFVIKVLDINDNQPEFLEGPYETSIPEMSPEGTSVIQVTATDNDDPSH
GNNARLIYSILQGRPYFSVEPTTGVIRISSQMDREAEDQYLVVVQATDMLGLPGGLSGTT
TVTINLSDVNDNRPIFQFGLYHMNVSESAPVGTSIGAILAEDSDIGDNAKMNYSIEDGSY
FFDIITNNETQEGIVILKQKLDYELQRQYSVRAKVTNSYIDEYFPKDENSGQTTVIKIRV
EDVDEPPVFSYLEYVMEIAEETPYGSHVGTVLARDPDATNSPIRYSIVGCSLFSIDDNGT
IIVTEPLDREIDAWHNLTVTATEKNNLQQVSEANVYVQVLNVNDHAPEFFHYYETYVCEK
ANTGELIQTISAVDRDASVEDHRFSFNLSTEAASNLSFIVRDNKDNTAGVLTTKSGFSRQ
EQPVFYLPILIADNGIPPLTSTNTLTIHACDCDENGGTQSCTYGALTFSMGFSTEGLIAI
LTCILIILVFVFIILGLKQGRKQALFPEKGEDFRENIVRYDDEGGGEEDTQAFDIAALRT
RTVMRARKTRKNITTEIRSLYRQSLQVGPDSAVFKEFILAKLEEANTDPCAPPFDSLQTY
AFEGTGSPAGSLSSLESSISDSEQNFDYLTELGPRFKKLASMYGSRIHAKN
Download sequence
Identical sequences F7CBY6
XP_007487832.1.35504 XP_007487833.1.35504 13616.ENSMODP00000026744 ENSMODP00000026744 ENSMODP00000026744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]