SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026754 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026754
Domain Number 1 Region: 14-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000654
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026754   Gene: ENSMODG00000021417   Transcript: ENSMODT00000027235
Sequence length 306
Comment pep:novel chromosome:BROADO5:3:281647118:282029796:1 gene:ENSMODG00000021417 transcript:ENSMODT00000027235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEAGFQATNALTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFVQIIIIIVVITVMVVVIICLLNHYKLSTRSFINRQSQNRRQEDTLQPEGCLWPSD
SSVSRQAASEIMYAPRTRDRFTAPAFMQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEP
PPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDISMYNGGPCPPSSNSGISAT
NCSSNGRMEGPPPTYSEVMGHYPGSSFFHHQHSNSQRGSRLQLQQNNSESTIVPIKGKDR
KPGNLV
Download sequence
Identical sequences F7CBP5
XP_007487815.1.35504 XP_007487816.1.35504 XP_007487817.1.35504 XP_007487818.1.35504 XP_007487819.1.35504 XP_016287180.1.35504 ENSMODP00000026754 ENSMODP00000026754 13616.ENSMODP00000026754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]