SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026805 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026805
Domain Number 1 Region: 2303-2489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.26e-36
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 2897-3076
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-35
Family Laminin G-like module 0.00000481
Further Details:      
 
Domain Number 3 Region: 2706-2886
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.05e-33
Family Laminin G-like module 0.0000701
Further Details:      
 
Domain Number 4 Region: 2132-2301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-29
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 2493-2679
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-27
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 6 Region: 852-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 7 Region: 802-854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 745-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 9 Region: 1406-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 10 Region: 905-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 11 Region: 1463-1513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 12 Region: 1047-1095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.052
Further Details:      
 
Domain Number 13 Region: 1511-1556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 275-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 15 Region: 362-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000019
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 16 Region: 402-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 17 Region: 954-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 18 Region: 708-747
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family EGF-type module 0.091
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026805
Domain Number - Region: 84-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000136
Family APC10-like 0.06
Further Details:      
 
Domain Number - Region: 998-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000268
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 1363-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family Laminin-type module 0.041
Further Details:      
 
Domain Number - Region: 457-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00179
Family Laminin-type module 0.025
Further Details:      
 
Domain Number - Region: 1108-1148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00213
Family Laminin-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026805   Gene: ENSMODG00000021454   Transcript: ENSMODT00000027286
Sequence length 3080
Comment pep:novel chromosome:BROADO5:3:273560918:273716661:-1 gene:ENSMODG00000021454 transcript:ENSMODT00000027286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRCCGLVLLVAVLLLWTTGQCQQRGLFPSILNLAANAVINSNATCGDDGPEMFCKLVEH
VPGQLIRNAQCRICDKNSLNPKERHPISNAIDGTNNWWQSPSIQNGREFHRVTVTLDLRQ
VFQVAYIIIKAANSPRPGNWILERSIDGIHFSPWQYYAISDTDCLVQYNITPRLGPPTYK
KDDEVICTSYYSKLVPLEHGEIHTSLINGRPGADDLSPTLLNFTSARFVRLSFQKIRTLN
ADLMTLSRRDPKDLDPIVTRRYYYSIKDISIGGMCICYGHANSCPLDATKKKLICKCEHN
TCGDSCDKCCPGFHQQLWKPGTISSGNTCEECNCHNKTKDCYYDQSVADQKKSMNLAGEF
KGGGVCINCQQNTAGINCETCADGYYRPHNVSPRDEYPCQPCNCDPWGSLSSICTKEDDL
WNDGNLAGQCQCKEGYTGQKCDRCQFGYKDYPRCSQCTCNEAGSISDLCDEPCLCKENVE
GDNCDVCKAGSFNLNKDNPEGCTECFCFGVSDVCDSLFWPVSEVTEMPGWLVTFIPQTKS
APSQQDQSFKPDQSSTNATENIEVPESEEYYWSAPLAYLGNKLTAFGRNLKYAMASDDPE
KTKDDSPLVSHAHVIIKGNGITISTKTEGVFRLHEKNLNVVKLVPENFRDHNTKKEIDRD
KLMTVLANVTQLLIKANFNKITKALNRLISVTLETANPNAISPELARDAEHCECPQGYTG
ISCESCLPGYYRVGGILFGGICQPCECNGHASDCDIHGVCIDCKDNTTGENCDQCLPGFY
GNASQGTPADCQPCKCPLSSSSNNFSPTCSLNNEDEVICDKCQTGYIGNQCERCADGYYG
NPTVFGESCIPCDCNDNVDPLESDNCDTVTGECLKCIGNTGGRHCERCADGYHGDAVVAK
NCSACWCHETGSVSNICNYETGVCNCKPNVIGQHCDQCANGYFDLKTGVGCQPCNCHKSG
SVSENCDDEGKCQCVPGVAGQKCDQCARGFYNYQDGSCTPCDCEHTQNSCDSESGECICP
PNTKGLHCEDCEDEHWGHDPDIGCKPCNCSNKGSTSHRCDLESGQCLCKKEYAGKKCNEC
AFGFRDYPDCVPCNCDGSGTREDTCDGKVCSCEKRTGFCTCKENVFGLHCSECKMGTFAL
HDENPLGCSPCFCFGMTRFCSELEGYIRIPITIIDEEKLLRVVSQDTQESTTEGVYYQSP
DVVLDVFTVREYIKAETLYWELPNEFLGDQLMAYGGKLKYIVTFYSLNGTGSSNGEPQII
IKGGRTNKFTIYANITTPKNGVRTYHEVDMIENYWKYFNSASEEYVIRSHFMLVLSNIDY
ILIKASHGQALLQSRIANISLEIGIKAEEGKYYSEEEIAYYLENCHCPPGTAGFSCQDCA
PGYHRAKFLKVSGNEALPLIASCVPCECNNHTETCHPETGQCLNCRDNTAGDHCDICAPG
YYGKVRGSVNDCSVCECPRSNASFSPTCHLVDENDFRCDACAPGYEGPYCEKCGSGYYGN
PFLIGGSCQACNCDPNGSVHGLCNTTSGQCICKPGVSGRACDKCKLRHVLVDLECVSCDD
ECVGVLLNVLDNVTDAISQMNFTGIIHVPYEILYNLENTTRNLRLSLRNNKNLVSLERTN
KQIEDMSEDLYHFETELTEIVGSSQYLKVVAEDIINKTQDLATLIQRVKTTINVIVEEAE
ALNETNSMQLPNSTLQNMHEDIASMLETVQKRNLTQLYQNATSELKASKNLLSLIQKDFQ
KPLQYLENLKEKTSNHFADYINQLQEAQAFVNDANAKTKEASSLLHISAINLEKVNDKKL
HVLEKLNSSLVFIEKGKKLLALIADFAKDAKNTTEMLELQQDELIFWSAKIRHHVDELVM
QMARRGALDLVYRAEDHAAELIRVADVLDRGLTDVKDISLNATTAVHAHSSIQSFIEDAK
NLVEEALRKTEITNLTVEPLVSHGKLALQRGTKFLREAHNLDGRTKGAMTKVNELKMKVN
IFQDRTHKLTKQLNDSLVMLGMMMPDGNWDAGLKTKELARVANVSAMSILSDVVDFSQKL
LHTSSELSRVNETLRKTTHILSDSSKTTSLVEKKIKEVKTQTSLLFDRLKPLKKLEENLN
RNLSEIKELINQARKQAASIKVAVSADRDCIRAYRPQISSTNYNTLMLNVKTTEPDNLLF
YLGSSASSDFLAVEMRHGKVAFLWDVGSGASRLEFSDFTIDNNKWHQIYVTRFGNTGSLS
IKEVSSTQKSSTKTAKSPGTANVLDVNESTVMFVGGLGGQIKKSSTVKVTHFKGCMGEAF
LNGKSIGLWNYIEREGKCDGCFGSSQNEDSSFYFDGSGYSIVEKTLRSTVTQIIMLFSSF
SPNGLLLYLTSNDTRDFLSIELVDGRIKLTVDLGSGPLVLITDKRYNNGIWYKIAFQRNR
KQGLLIVNDAYNTTSKETKQGESPGGSSDLNRLNKDPIYVGGLPRTKVLRKGITSRSYVG
CIKSLEISRTTFDLLRNSYGVRKGCSLEPIRSASIFNEGYIELPPKPLLTESELMVTFAT
KTNSGIILSGLTTGKEKRSRRQANVPFFSIMLIDGDLEIHVNPGDGMSTRKATLSSTTGT
YSDGQEHSIVLIRNKRTITVQVDEANQTEMRFGALAETRILNVSHLYIGGIPEDEVIYAL
KIRKSFYGCIKNLIFNMELLDFSTAVRYEKVDMDSCLLTERLQPLIHEEDVERQPEAHPL
LSLEQCVVDGEPDYVPNAHQFGLTSGSHLILPFNQFAVRKKLSVQLSIRTFARSGLIYYM
AHQNQIDYATLQLHEGQAYFMFDLGKGKAKASHPAFLSDGKWHTVKTEYMKRKGSITIDG
QESTMVSTIGDGNTLDVEGKFYLGGLPLSYKAKNIGNITHGIPACIGEVMINNKQLDMNN
PISAFSLNKCYTMTQEGTFFNGTGFLALVKEGYKVRSDVTITLEFRTSEMNGVLLGISSA
KVDAIGIEIINGKVLFHVNNGAGRITAVYEPKSTNSLCDGKWHKLQANKSKHQITLIVDG
KSSSAESPHTQSTSADTNNPIYVGGYPADVKQNCLSSRTPFRGCMRKLTLTKAQQVESFD
FSKGFDLQGVFPHSCPGNEN
Download sequence
Identical sequences F7GLQ6
XP_007487757.1.35504 ENSMODP00000026805 ENSMODP00000026805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]