SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026843 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026843
Domain Number 1 Region: 73-395
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-65
Family Protein kinases, catalytic subunit 0.0000176
Further Details:      
 
Domain Number 2 Region: 928-994
Classification Level Classification E-value
Superfamily G protein-binding domain 4.19e-22
Family RhoA-binding domain 0.0000604
Further Details:      
 
Domain Number 3 Region: 1098-1188,1269-1300
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000616
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1201-1255
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 5 Region: 407-509
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000902
Family Myosin rod fragments 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026843
Domain Number - Region: 690-758
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00889
Family Myosin rod fragments 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026843   Gene: ENSMODG00000021484   Transcript: ENSMODT00000027324
Sequence length 1334
Comment pep:novel chromosome:BROADO5:3:264276041:264401763:1 gene:ENSMODG00000021484 transcript:ENSMODT00000027324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGDSFETRFEKIDNLLWDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSKYK
DTISKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLYYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKKITLLENVTELTSLM
WTSTVLMWTVLTMLYKEFEDSLVGTYSKIMSHKNSLTFPDDNDISKEAKNLICAFLTDRE
VRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGDEETF
PVPKAFVGNQLPFVGFTYYSNRRYLSVSSVNPNDNRTATSVDKSLQESLQNTIYKLEEQL
HNEIQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRKNLESTVSQIEKEKMLLQHRVNEYQ
RKIEQENEKRRNIENEVSTLKDQLDDLKKISQNSQLTNEKMAQLQKQLEDANDLLRTESD
TAVRLRKSHTELSKSVSQLESLNRELQERNRILETTKSQVDQDYYQLQAALEAERRDRSH
GSEMIGDLQARITSLQEEVKYLKHNLERVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKS
LQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMYEMEKKLKEERAAREKAENRVVHIEK
QCSMLDVDLKQSQQKLEHLAEHKERIEDEVKNLTLQLEQESNKRLLIQNELKTQAFEKDN
LKGLEKQMKQEINMLLEAKRSLEFELAQLTKQYRGNEGQMRELQDQLEAEQYFSTLYKTQ
VKELKEDIEEKNRENLKKIQELQNEKDTLTAQLDLAETKAESEQLARRLLEEQYFELTQE
CKKAASRNKQEITDKDHTVGRLEEIKTTLTKDIELLRKENEELAEKMRKEQEDYKLKKEE
EINNLKASFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQL
ELNQEREKFNQMVVKHQKELNEMQAQLVEECTHRNELQMQLASKESDIEQLRAKLLDLSD
STSVTSFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDK
EQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDLEMEPVQQAE
KTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFPPPALECRRCHVKCHRDHLDKKEDLI
SPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPPSSFVRASPRTLSTRSSANQ
SFRKVVKNTSGKTR
Download sequence
Identical sequences F7G2Y1
ENSMODP00000026843 ENSMODP00000026843 13616.ENSMODP00000026843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]