SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026883 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026883
Domain Number 1 Region: 159-298
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-31
Family Cadherin 0.00000269
Further Details:      
 
Domain Number 2 Region: 390-514
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-26
Family Cadherin 0.00062
Further Details:      
 
Domain Number 3 Region: 280-398
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-21
Family Cadherin 0.00011
Further Details:      
 
Domain Number 4 Region: 69-163
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-16
Family Cadherin 0.00000303
Further Details:      
 
Domain Number 5 Region: 503-610
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000113
Family Cadherin 0.0022
Further Details:      
 
Domain Number 6 Region: 4-82
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000879
Family Cadherin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026883   Gene: ENSMODG00000021517   Transcript: ENSMODT00000027365
Sequence length 810
Comment pep:novel chromosome:BROADO5:3:255120066:255194248:1 gene:ENSMODG00000021517 transcript:ENSMODT00000027365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHAKFLIYAQDKETQEKWQMAVKLSLNPTITDNLMKEPQEIEEIVFPRQSSNHNGYLQR
QKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPIS
GQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTV
PEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPVSPSSNMFTINNETGDIITVAAG
LDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRV
DVIVANLTVTDKDQPHTSAWNAVYKITGGDSTGHFTIQTDPNSNDGLVTVAKPIDFETNR
MFLLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPHFNPNPKLVRHEEGLRAGTML
TTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPNVKNNMYNATFL
ASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITALDYDIDPNAGP
FAFDLPLSPASIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNTSVL
RVKVCQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAK
QLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIHA
EPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSS
SSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Download sequence
Identical sequences F7FSE9
ENSMODP00000026883 ENSMODP00000026883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]