SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026954 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026954
Domain Number 1 Region: 42-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.14e-36
Family Pentraxin (pentaxin) 0.00000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026954   Gene: ENSMODG00000022529   Transcript: ENSMODT00000028383
Sequence length 239
Comment pep:novel chromosome:BROADO5:Un:94564208:94566031:1 gene:ENSMODG00000022529 transcript:ENSMODT00000028383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKWLLWTLLLITFSRTMALTENHEEENKERQRLPTQSLYKDLHRKVFLFPASSADSYVT
LSPLKNTELQNFTVCLWTYTELTRGYSVFSYATQASTNEILLFRDSVGQYSLTVGSEEVT
FQVQEPSFTPINICATWASASGVAEIWVDGIPLVRKVLKQGYTLSANAMIILGQDQDSYG
GGFDINQSFLGEIGNVYMWDYVVPFHEGKTNCSQANVLNWKKMKYEKMGHVIMVPQLRD
Download sequence
Identical sequences H9H833
ENSMODP00000026954 XP_001381105.2.35504 ENSMODP00000026954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]