SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027025 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027025
Domain Number 1 Region: 14-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.71e-29
Family Laminin G-like module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027025   Gene: ENSMODG00000022646   Transcript: ENSMODT00000028512
Sequence length 162
Comment pep:novel chromosome:BROADO5:Un:65082128:65082613:-1 gene:ENSMODG00000022646 transcript:ENSMODT00000028512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVLTLALARGAAGLEFGGGPGQWARYGRWAGAASSGELSFSLRTNATRALLLYLDDGGN
CDFLELLLLDGRLRLRFALSCAEPATLHLDTPVADDRWHMVLLTRDARRTALAVDGEARA
AEVRSKRRHMEVASDLFVGGIPPDVRLSALTLSTVKYEPPFR
Download sequence
Identical sequences H9H8A4
13616.ENSMODP00000027025 ENSMODP00000027025 ENSMODP00000027025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]