SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027057 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027057
Domain Number 1 Region: 288-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-38
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 4-75
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-17
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 86-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000275
Family B-box zinc-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000027057
Domain Number - Region: 131-245
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00288
Family Apolipoprotein A-I 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027057   Gene: ENSMODG00000022680   Transcript: ENSMODT00000028559
Sequence length 459
Comment pep:novel chromosome:BROADO5:Un:56584570:56589830:-1 gene:ENSMODG00000022680 transcript:ENSMODT00000028559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEPMQDFQKELICSICKEYLANPISIECGHSFCHSCLFCSWQAASLRFSCPECRAVSQLR
DFQVNVRLGKLVAFAKNLRPPSLQNPEGQKQCEIHQKTYKLFCEDDQSLACLDCFESQKH
KAPTLYCIDEAAESYRAKLQETAMNLRKKTKYVVKQILVGNVKMQLWEKMVKDQKINISS
EFRKLHQFLDEEKTEYLSIVERHKMDGVKGLKKRITELSQHSQELRKMITDLEEKYRKPQ
VDLLQQNPSLLITGDLNLVFIFSRNELVLQKDDSFLIDIIICPIPRIIEMLLKFKVEITL
DCNTASAGLIISEDLKNVRYGGTQVEEVLNNSGIGGFAQVFGIQSLTSGRYYWEVEAPSN
TGWCIGICNPNLLEEIFVLIAIQSHSGHQLYALGLHHISHKTYVKYCQNYVSKLMVGIFF
DYERREISFYNVKERSLIFTFATFSSSGPFFPIFGLSRK
Download sequence
Identical sequences H9H8D5
ENSMODP00000027057 ENSMODP00000027057 13616.ENSMODP00000027057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]