SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027276 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027276
Domain Number 1 Region: 461-538
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.37e-25
Family Intermediate filament protein, coiled coil region 0.00029
Further Details:      
 
Domain Number 2 Region: 229-263
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000507
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 268-339
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000126
Family Intermediate filament protein, coiled coil region 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000027276
Domain Number - Region: 395-461
Classification Level Classification E-value
Superfamily Prefoldin 0.00288
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027276   Gene: ENSMODG00000020938   Transcript: ENSMODT00000028818
Sequence length 650
Comment pep:novel chromosome:BROADO5:Un:26970340:26979843:-1 gene:ENSMODG00000020938 transcript:ENSMODT00000028818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNPLNHSDLEEIFQPSPALRRYKGEGEDLLLRITEPPSSSELCYCLSKTSPLLGPSALR
ITMSRQSSVSFQSGGRRGFSASSAITPSVSRTSFSSVSMSRAGGGGGGGGYGRVSVGGSG
GGFGSRSLYNFGMSKRISMGGSGGFRSGYGGRVGGGYGFGGGAGSGFGFGGGAGGGLGLG
GGAGFGGGYGGAGFPVCPPGGIQEVTVNQSLLAPLNLQIDPTIQRVRTEEREQIKTLNNK
FASFIDKVRFLEQQNKVLDTKWTLLQEQGHKTTRQNLEPLFESYINNLRRQLDSILNDRG
RLDSELRNMQDTVEDFKNKYEDEINKRTTVENDFVILKKDVDTTYMSKVELEAKVESLGD
EVNFTRTLFEMELSQMQGHVSDTNVVLSMDNNRNLDLNSIIAEVKAQYEDIANRSRTEAE
SWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNIKKQCANLQASIADAE
QRGELALKDARAKLAELEDALQKAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEE
CRLSGEGVGPVNISVVTSSVSSGYGSGGGYGSGGGYGSGGGYGLGGGLGGGSGGYSYSSG
GGGGLSVGGSGFSSGSGRGLGLSLGGGGGSSSSVKFVSTTSSSSRKSFKS
Download sequence
Identical sequences H9H8Z6
ENSMODP00000027276 ENSMODP00000027276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]