SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027392 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027392
Domain Number 1 Region: 288-455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-42
Family SPRY domain 0.0000722
Further Details:      
 
Domain Number 2 Region: 14-81
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-18
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 99-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000504
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027392   Gene: ENSMODG00000022818   Transcript: ENSMODT00000028933
Sequence length 463
Comment pep:novel chromosome:BROADO5:Un:16918807:16923637:-1 gene:ENSMODG00000022818 transcript:ENSMODT00000028933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTRLRNMEAKELIESLKAELTCSICLGYFTDPVTALKCGHTFCKDCLLQCDEQADATLTC
PECRAVIRYSDIVPNENLQNLSITGKTLRQHLLLSPALLTTCDQHGKKEKLFCEQDQKPI
CDSCLLTQEHKDHQDLPLQMAADKCKKNLQETLNVLQQKEEELKAEINNILKEEKYFKKD
SDFYKELIRCEYRKMHEILYNEENRHLQKLDQEIEDKLAKVEANKAKLSQQIQHVQQKIL
EIEESLDEAPLEMLQDMKGILERNEELQLQDTETVKLTYTTYQVTGLIEILRSYQTGITV
DPETDRLHLIVPEHFKSLKYRLDPRNQPENEERLDYFVIMLGTETFTSGQHYWEVDVEGQ
TEWVLGICEDSVSKNENLSMLSEDVKAIIGSKVKNQTLFWSSEGCFCSTPPCKLGIFLDY
DEGNITFYDVNEKTVLISFLNSPFQGPVRPFYSTSLVNKGSSS
Download sequence
Identical sequences H9H9B2
ENSMODP00000027392 ENSMODP00000027392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]