SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027406 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027406
Domain Number 1 Region: 323-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.88e-47
Family SPRY domain 0.0000564
Further Details:      
 
Domain Number 2 Region: 12-87
Classification Level Classification E-value
Superfamily RING/U-box 9.5e-20
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 101-160
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000412
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027406   Gene: ENSMODG00000003259   Transcript: ENSMODT00000028947
Sequence length 504
Comment pep:novel chromosome:BROADO5:Un:16725670:16733260:1 gene:ENSMODG00000003259 transcript:ENSMODT00000028947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFFTDSSSPGFKNMDAKNLTENLKAELTCPICLSYFTDPVTVKCGHSFCIECLLRCKEGA
NETLVCPECRGIIKYSDLILNRSLQNLSITGKKVRPHLLQSMVTICDNHWEKEKIFCEED
HRLLSDPCLLSQEHKDHQVLPLEMVADRCKKRLQETRNILKIREEEFKMALDSVERIKTQ
YKKDIYTLKQSVIYEYEEMHQFLLEEKNLQLQRLGEESRDNLAKLEEDKAKLSQQIKKLQ
QMILEVEENLDKAPLETIQEIKKTKEQNTKAVIYFLPSGYESHLGKVNNSNRMCPICRSE
KLMLQEPEVTSPNWITCSITGLREMLMSFHTDITLDPKTINPPLILSEDMKSVEYRRAPQ
DLLNNEEKFNYVFKVLGTQIFSSGKHYWEVEVGYQIGWEVGICEINKKVTHSTIFENIRT
IVSFKFGNNFFHWNSQGGYHVSQPVNKVGIFLDVEKGYIAFYDAMNNSLIYSLQNVVFRR
PLCPFFSPCLPVGMSSYGYLMVCP
Download sequence
Identical sequences H9H9C6
13616.ENSMODP00000027406 ENSMODP00000027406 ENSMODP00000027406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]