SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027497 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027497
Domain Number 1 Region: 236-476
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-32
Family YWTD domain 0.0000965
Further Details:      
 
Domain Number 2 Region: 62-189
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-25
Family YWTD domain 0.00023
Further Details:      
 
Domain Number 3 Region: 581-620
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 4 Region: 541-579
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 5 Region: 192-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.035
Further Details:      
 
Domain Number 6 Region: 499-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000191
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027497   Gene: ENSMODG00000021325   Transcript: ENSMODT00000027131
Sequence length 929
Comment pep:novel chromosome:BROADO5:Un:7302951:7331233:-1 gene:ENSMODG00000021325 transcript:ENSMODT00000027131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSLSLSLSLSLSLSLSLSLSPSLSLSLSPSLSVSPSPFPFPSPFIIPYKSCCFSFCSH
FRYLYWTEWGGKPRIVRAYMDGTNSVTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESS
NMLGQERVIIADDLPHPFGLTQYSNYIYWTDWNLHSIERADKVNGKNRTLIQGHLDFVMD
ILVFHSSRQDGLNDCVQNSGHCGQLCLAIPNGFRCGCATHYTLDPNHRNCSSPTTFLLFS
QKCAISRMIPDDQHSPDVVLPVHGLRNIKAIDYDPLDRFIYWVDGRQNIKRARDDGTQPF
VVTSTNQGQNSEKQPHDLSIDIYSHTLYWTCETTNTINVHRLNGEAIGVVLRGDHDKPRA
IVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDA
DLKRIESCDLTGANRVTLEDSNIVQPLGLTVLGSHLPAGRRDPARVSLLAAVGGGIRALV
GRAARTPPEPARFPSAAAHPCSRDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEP
PTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEADCPVCSAAQFQCEKGQCIDLRWR
CNGEVDCQDKSDEADCDGSLCLMKQLLPVSGQLRTGSSSSSSPFVATATPSTLPLLFPLA
EITKPPSDDPPSHSSAIGPVIGIILSLFVIGGMYFVCQRVVCQRYAGPSGPFPHDYVSGT
PHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSSGLPLYDRNHVTGASSSSSSSTK
ATLYPQILNPPPSPATDRSLYNTEMFYSSNIPSTTRSYRPYIIRGIAPPTTPCSTDVCDS
DCTSSRWKASKYYMDLNSDSDPYPPPPTPHSQYLSAEESCPPVTSHRAELLPSLPATPLT
LHRLHLTSAPPPGPASPPANIFQYEQSKI
Download sequence
Identical sequences H9H9L7
ENSMODP00000027497 ENSMODP00000027497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]