SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027503 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027503
Domain Number 1 Region: 2238-2354
Classification Level Classification E-value
Superfamily Cadherin-like 8.38e-32
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 832-957
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-29
Family Cadherin 0.00075
Further Details:      
 
Domain Number 3 Region: 196-303
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-27
Family Cadherin 0.00076
Further Details:      
 
Domain Number 4 Region: 1804-1907
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-27
Family Cadherin 0.00052
Further Details:      
 
Domain Number 5 Region: 1147-1270
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-27
Family Cadherin 0.0018
Further Details:      
 
Domain Number 6 Region: 1261-1367
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 7 Region: 2137-2242
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 8 Region: 1369-1485
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 626-729
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 10 Region: 1586-1700
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 731-844
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 12 Region: 407-512
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 13 Region: 2340-2465
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 14 Region: 1478-1584
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 15 Region: 938-1062
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 16 Region: 296-405
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 17 Region: 2027-2135
Classification Level Classification E-value
Superfamily Cadherin-like 4e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 18 Region: 1043-1166
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-19
Family Cadherin 0.0043
Further Details:      
 
Domain Number 19 Region: 513-620
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-18
Family Cadherin 0.0018
Further Details:      
 
Domain Number 20 Region: 1694-1802
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-18
Family Cadherin 0.00062
Further Details:      
 
Domain Number 21 Region: 1908-2026
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-16
Family Cadherin 0.001
Further Details:      
 
Domain Number 22 Region: 2577-2696
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000814
Family Cadherin 0.0027
Further Details:      
 
Domain Number 23 Region: 2456-2551
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000385
Family Cadherin 0.0014
Further Details:      
 
Domain Number 24 Region: 85-193
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000971
Family Cadherin 0.0057
Further Details:      
 
Domain Number 25 Region: 2-92
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000357
Family Cadherin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027503   Gene: ENSMODG00000000318   Transcript: ENSMODT00000029043
Sequence length 3062
Comment pep:novel chromosome:BROADO5:Un:6525978:6885794:1 gene:ENSMODG00000000318 transcript:ENSMODT00000029043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLNGVLDRENPLYSHGFILTVKG
TELYDDRTPSDASCITTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDK
DEGLNSMFEVYLVGNNSHHFIVSPTSIQGKADIRMRVAQPLDYETVPRYEFDMFANESVP
DHVGYAKVKISLINENDNRPIFSQPLYNVSLYENVTVGTTILTVLATDNDAGTYGDVYYF
LSDDSDRFSLDKDTGLITLIGRLDYELIQRFTLTIIARDGGGEETTGRVRVNVLDVNDNI
PTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIVNASLFGSYFDISVYEGY
AVISVNRPLDYEQIPNGMIYLSVMAKDAGNPPLNSTVPVTIEVFDENDNPPTFSKPSYSV
TVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRET
KSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVT
TVVAVDPDLAENGTLVYSIHPPNKFYSINSTTGKIRTTNVMLDRENPDPEEAELMRKIIV
SVTDCGTPPLRATSSATVFVNLLDLNDNDPTFQNLPAIAEVLEGTLAGVPVYHVVAIDLD
EGLNGLVTYRMQVGMPRMDFVINSSSGVVTTTTELDRERIAEYYLRVVASDAGTPTKSST
STLTIRVLDVNDETPTFFPAVYNVSLLEDIPRDFRVVWLNCTDNDVGLNAELSYFITGGN
IDGKFKIGYRDAVVRTVVNLDRETTAAYTLIVEAIDNGPVGKRRTGTATIYVTVLDVNDN
RPIFLQSSYEASVPEDIPEGSSIVQLMATDADEGDNGRVWYRILHGNHGNNFRIHVSSGL
LVRGPRPLDREQNSSHVLVVEAYNYDLGPMRSSVRVIVYVEDVNDEVPVFTQQQYSRLGL
RETAGIGTSVIVVRATDRDTGDGGLVIYRILSGSEGKFEIDESTGLIITIDYLDYETKTS
YLMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEAAIMENLPWGSEVVRVQAF
SIDNINPIVYRFDPYTSPQARALFKIDSVTGVITVKGLVDREKGDFYTLTVVADDGGPKI
DSTVVYITVLDENDNSPQFDPTSDSAVNVPEDYAVGRRVAVVTARDADIGSNGQVSFYLA
SGNIGGAFEILTSNDSVGEVFVARPLDREELDHYILKIVAIDGGSPPRKKDHILRITILD
VNDNPPIIESPFGYNVSVNENVGGGTAVVQVIATDRDIGINSVLSYYITDGNEDMTFRMD
RVTGEISTRPSPPDRERQSFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPQY
EILLDEGPDTLNISLITIQALDLDEGPNGTIAYAIIAGNIINTFQIDSVTGVISTLKELD
YEISHGRYTLIVTATDQCPILSRRLTSTTTVLVNVNDINDNVPIFPRDYEGPFDVTEGQP
GPRVWTFLARDLDSGPNGQVEYSIVDGDPLSEFLISPVEGELRVRKDVELDRENIAFYNL
TICARDRGIPPLSSTMLVGIRVLDINDNDPVLLNLPMKITISENSPVASFVAHILASDAD
SGPNALLTFNITAGNRNNAFFINATTGIITVNRPLDRERIPEYKLTISVKDNPENPRIAR
RDFDLLVISLEDENDNHPLFTQSTYQAEVMENSPAGTPITVLNGPILALDDDLGINAVVT
YKLLGTESGLFDIDHATGVVVVKPGVVIDREAFFPPILELLLLAEDIGLLNGTAELIITI
LDDNDNRPIFTPSTLTVHLQENCPPGLSVLQVTATDEDSGLNGQLVYRIQAGAQDRFMIH
PLTGVIRVGNITIDREEQESYRLVVVAADRGTVPLSGTAIITILIDDINDSRPEFINPIQ
TVSVLESVDPGTVIANVTAIDRDLNPELEYYIIDIVAKDDTDRLVPNQEEAFAVNINTGS
VMVKSPLNRELVATYEVTISVIDNASDLPENAVSVPNAKLTVNILDVNDNTPQFRPFGIT
YYTERILEGATPGTTLIAVSAYDPDKGVNGQITYTLLNMVPPGYVQLEDSSAGKIISKRT
VDYEEVHWVNFTVQAADNGSPPRAAEIPVYLEIVDINDNNPIFDQLSYQESVFEDTPVGT
VILTVTATDADSGAFALIEYSLVDGEGKFGINPTTGDIYVLSSLDRETKAHYILTALAKD
NPGDIPSNRRENSVQVVIQVLDVNDCRPQFSKPQYSTSVYENEPAGTSVITMMATDQDEG
ENGELAYSIEGPGVEAFQVDKDSGLVTTRRPLQSYERFNLTVVATDGGQPPLWGTTMLYV
EVIDVNDNRPVFVRPPNGTILHILEEIPLRSNVYEVYATDQDEGLNGAVRYSFLKTTGNR
DWEYFTIDPISGLIQTAKRLDREQQPMYSLILVASDLGQPVPYETMQPLLVALDDIDDNE
PIFVRPPKGSPQYQLLSVPEHSQPGTLVGNITGAVDADEGPNAIVYYFIAAGNEEENFLL
KKDGRLLVIRDLDREREALFSIIVKASSNRSWTLPRGPGASQALDLMTDLTLQEVRIVIE
DINDQPPRFTKSEYTAGVATDAKVGSELIQVLATDDDIGNNSLVFYSILAIHYFREHSND
SEDVGQVFTMGSVDGILRTFDLFMVYSPGYFVVDIIALDLAGHNDTAIVGIYILRDDQRV
KIIINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDQRGRVNFAQTELLIHVVNRD
TNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAITPRLPEDMSNLQMAIIILAILLF
LAAMLFILMNWYYRTVHKRKLKAIVAGSTGNRGFIDIMDMPNTNKYSFDGANPVWLDPFC
RNLELAAQAEHEDDLPENLSEITDLWNSPARTHGTFGREPSAVKPEDDRYLRAAIQEYDN
IAKLGQIIREGPIKLIQTELEEEVADRSLGQGSLRFRHKQPIELKGPDGIHVVHGSTGTL
LAADLNSLPEDDQKVLGRSLETLTAEAGAYNERNARTESAKSTPMHKMREVIMESPLEIT
EL
Download sequence
Identical sequences H9H9M3
XP_007505692.1.35504 ENSMODP00000027503 ENSMODP00000027503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]