SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027815 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027815
Domain Number 1 Region: 284-366
Classification Level Classification E-value
Superfamily DEATH domain 6.18e-17
Family DEATH domain, DD 0.0014
Further Details:      
 
Domain Number 2 Region: 85-141
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000283
Family TNF receptor-like 0.0014
Further Details:      
 
Domain Number 3 Region: 31-85
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000113
Family TNF receptor-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027815   Gene: ENSMODG00000014002   Transcript: ENSMODT00000029352
Sequence length 375
Comment pep:novel chromosome:BROADO5:6:196969734:196979933:-1 gene:ENSMODG00000014002 transcript:ENSMODT00000029352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWHRRWPRPWLLWLLLRPLLQPQVWAGQLCPSGLFPWGGLCCNRCPPGWRTPEPCGEVD
AQCRPCPSNETSPLEGTSEPCQPCCSCPLGHFLNSTHHCQPCKACPPGNEARIPCGKGTD
TVCQPCPPGTYSKESSIQEPCKACTHCNQSKVVVLACTRLFDTLCMDEELHTLIRDAEAK
GADLNVSSTFPAPPPDSGIIIPIYCSLLAAVVVGLLAYVAFKCWRTCKQKQQLAKARAGE
LGVTEGEKLNSDSSICLDTTGLHELHGLGKGAQLEPCRWHLYGQLPRGQQEEVEQLLEAG
SPAGWQVLAEQLGFETEAVETMGRDPAPAHTLLNNWATQGGSGATLERLEASLRAIGRED
VARALSGSDEGNSMV
Download sequence
Identical sequences F6VY06
ENSMODP00000027815 XP_007499788.1.35504 ENSMODP00000027815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]