SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027848 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027848
Domain Number 1 Region: 25-507
Classification Level Classification E-value
Superfamily Cytochrome P450 7.73e-69
Family Cytochrome P450 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027848   Gene: ENSMODG00000022964   Transcript: ENSMODT00000029385
Sequence length 508
Comment pep:known chromosome:BROADO5:6:200232362:200233888:1 gene:ENSMODG00000022964 transcript:ENSMODT00000029385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALWVFVFIILVSSVLVVLYALGVLRQRRAREPPLDKGPIPWFGYTWHLSKDASSFLKKM
HRRYGNIFTILLGGKYVTFVTDPLSFDAILKENRSKLDFSNFASQLVFKIFEFQGPKQYQ
KVLKSHSTKYLMGSSLAVMTQAMMDNLQVLLLELDADMKPGLQEWKQDGLLEHCYNIVFR
AGYLALFGSLPTSGKSGHIQDLLRSQKVFEEFRKFDRLFPRAFLSALLPNEKQEMKRLRR
FFWDILAPQKILEKDNVSPWIYFSQQQLADSGVSDIGQSQNNLILLWASQGNTGIVSFWA
LLFLLKNPGALKAVREEAEGILRKMGKERRPGGVPIQVEYSMLQQTPVLDSVMEETLRLV
VAPFLTRSVMQDMILKMDDGREYALRKGDEVCVFPYLFLHMDPEIYPDPTTFKYDRFLNL
DGSQKVDFYKQGRRIKSYMLPWGAGPSLCPGRFFALNEMKMFVFLMVTQYDIELVDQEVE
IPPINVKRWGIGAMQPIYDVQFRYRMRF
Download sequence
Identical sequences F6VFN6
ENSMODP00000027848 13616.ENSMODP00000027848 ENSMODP00000027848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]