SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027864 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000027864
Domain Number - Region: 7-48
Classification Level Classification E-value
Superfamily DEATH domain 0.00294
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027864   Gene: ENSMODG00000013333   Transcript: ENSMODT00000029401
Sequence length 785
Comment pep:novel chromosome:BROADO5:6:202018522:202086417:-1 gene:ENSMODG00000013333 transcript:ENSMODT00000029401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNSLENTISFEEYIRVKARSIPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGN
CIYTDSTEVAGSLLELACPVTTSVQQQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQQL
SPQLTVHQASEQPIQVQVQIQGQAQQQASQAIQSQTLQSPSPSQLQAAQIQVQHVQTAQQ
IQATEIQEEHIQHQQIQAQLVAGQAIAGGQQIQIQTVGALSPPPSQQGSPREGERRISTA
SVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATG
TITSPTGETWTIPVYSAQPRGDLQQQNITHIAIPQEAYNAVHVSGSPTALTTVKLEDDKD
KMVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVAVQAVAGAYQNAAQTSSVHTPH
PTPEPTPTPMKTPPLPVQTKSLGQMPETLNEVICSAQTVQVAEVEPQAQPQPSPELLLPN
SLKPEEGLEVWKSWAQTKNAELEKDAQNRLAPIGRRQLLRFQEDLISSAVAELNYGLCLM
TREARNGEGEPYDPDVLYYIFLCIQKYLFENGRVDDIFSDLYYVRFTEWLHEILKDVQPR
VTSLGYVLPSRVTEEMLWECKQLGAHSPSTLLTTLMFFNTKYFLLKTVDQHMKLAFSKVL
RQTKKNPSNPKDKSTSIRYLKALGIHQTGQKVTDDMYAEQTENPENPLRCPIKLYDFYLF
KCPQSVKGRNDTFYLTPEPVVAPNSPIWYSVQPINREQMEQMLTRILVIREIQEAIAVAN
ASNMH
Download sequence
Identical sequences F6UYF6
13616.ENSMODP00000027864 ENSMODP00000027864 ENSMODP00000027864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]