SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027974 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027974
Domain Number 1 Region: 267-344
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.45e-23
Family Intermediate filament protein, coiled coil region 0.0000878
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000027974
Domain Number - Region: 97-151
Classification Level Classification E-value
Superfamily Hyaluronidase post-catalytic domain-like 0.0262
Family Hyaluronidase post-catalytic domain-like 0.0098
Further Details:      
 
Domain Number - Region: 179-263
Classification Level Classification E-value
Superfamily Prefoldin 0.0523
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027974   Gene: ENSMODG00000016731   Transcript: ENSMODT00000029553
Sequence length 446
Comment pep:novel chromosome:BROADO5:1:737606142:737611041:1 gene:ENSMODG00000016731 transcript:ENSMODT00000029553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFGYEPYYATAYKRRYASTAESPRVHISSVRSGYSSTARSAYSSYSAPASSAALSVRR
SYSSSSASLLPSLESLDLSQVAAISNDLKSIRDLRLAVEDASAEKQALQGERDGLEETLR
ALQARYEEEVLSREDAEGRLMEARKGADEAALARAELEKRIDSLLDEIAFLKKVHEEEIA
ELQAQIQYAQISVEMDVSAKPDLSAALKDIRSQYEKLAAKNMQNAEEWFKSRFTVLTESA
AKNTDAVRAAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISALQDTI
NKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSLTSG
YSQSSQVFGRSAYGGLQTSSYLMSARAFPSYYTSHVQEEQIEVEETIEATKAEEAKDEPP
SEGEGEAEEEEKEEGEEEEGGEEEEG
Download sequence
Identical sequences F6S064
ENSMODP00000027974 ENSMODP00000027974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]