SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028225 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028225
Domain Number 1 Region: 146-252
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-24
Family Cadherin 0.00012
Further Details:      
 
Domain Number 2 Region: 253-368
Classification Level Classification E-value
Superfamily Cadherin-like 7e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 370-476
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-19
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 470-574
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-18
Family Cadherin 0.0028
Further Details:      
 
Domain Number 5 Region: 74-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000002
Family Cadherin 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028225   Gene: ENSMODG00000006956   Transcript: ENSMODT00000029806
Sequence length 769
Comment pep:novel chromosome:BROADO5:1:682757432:682783072:1 gene:ENSMODG00000006956 transcript:ENSMODT00000029806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLFKFLLLLFLKLYVSFISFSYHKTEDFFQTSSLSRAQDVRPRMKRDWIWNQMHIQEEM
PGTLPHHVGKITSSVNRKNARYVLKGPEAGKGKLFGVNEHTGDVYAFERLDREKKSEYYL
TAYIVDKDTNQNLEPPSNFTIKVHDVNDNVPEFAQRLFNGSVPEMSAVGTSVTRVTAVDA
DDPTVLGHASVTYNIIQGREYFTIDGSGTIFTTVHNLDREKQSKYEIVVEAKDGPGLHGE
SSTATVVITVSDINDNFPIFTQTNYKFVVPEDIRVGSSLGSLTVEDPDEPQNRMTKYSIV
QGEYRDTFIIELDASRNEGIIKPMKPLDYENIKEYSFSIEATDPTINLRYLNKAPPKNLA
LVYINVTDVDEPPVFSQPFYHFKMPENQRVNSVGSVLAKDPDAAQWNIGYSIRKTSDRGQ
FFRITKQGYISNIKELDREIYPWYNLTIEAKEMKPQESIVQVYIEILDENDNAPEIPHPD
DAKVCENAAPGTLVTRILAIDKDITPPDVKFKYSLIKEDSNFTLTENRDNSANITVKYGQ
FDRERAKVHYLPVVIADNGRPSLTGTTTLTITVCKCNDRGEPTFCEEPEMQVGVSIQALV
AIFLCILTIVVITVLIVLRRRLRKQDRAQGKNVAEIHEQLVTYDEEGGGEMDTNSYDVSV
LNSARKSNTRPSLYAQIQKPPRPAHPQAVTGEMAVMIEVKKDEADHDGGGPPYDTLHIYG
YEGAESIAESLSSLVTDSSDSDIDYDFLNDWGPRFKMLAELYGTEPSHE
Download sequence
Identical sequences F7CRQ5
ENSMODP00000028225 ENSMODP00000028225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]