SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028415 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028415
Domain Number 1 Region: 35-494
Classification Level Classification E-value
Superfamily Cytochrome P450 2.36e-120
Family Cytochrome P450 0.000000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028415   Gene: ENSMODG00000002737   Transcript: ENSMODT00000029997
Sequence length 495
Comment pep:novel chromosome:BROADO5:2:537463328:537483339:-1 gene:ENSMODG00000002737 transcript:ENSMODT00000029997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VISHMFSLATGLAILATSFLLLRMLAFFLARTQFPPGPCPLPILGNLLQLRFQLHPEKLS
QVGKYGSIFTVWLGSTPVVVLNGFQAVKDALVTHSEDFADRPVTPLFEDLFGDKGIISTS
GHAWQQQRRFGLITLRALGMGKKVLEQRLQEEAQYLVEIFHRQNGTSFDPHVPIVRAAAN
VICALVFGHRFPHGDPFFQELMKAIDFGLAFFKEPSSTCSLYDAFPWLLRQLPGPHRKIF
RYQEIVKSLICQEIERHKQRVPEDLEDFISCYLAQITKRKDDPASTFDEENLIQVIIDLF
LGGTETTATTLRWALLYMIHHRDVQGKVQQELDTVLGPSRVISFKDRKLLPYTNAVLHEV
QRFCSVISVGAVRKCGTATTVQGFPIQKGTIVLPNLASVLCDPEHWETPWQFNPGHFLDG
EGNFVIHEAFLPFSAGHRVCLGELLAKVELFLVFAHLLREFRLRAPAGASTNERDYILWG
TKQPRPYDICASPRL
Download sequence
Identical sequences F7AZK5
ENSMODP00000028415 13616.ENSMODP00000028415 ENSMODP00000028415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]