SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028426 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028426
Domain Number 1 Region: 9-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-34
Family Laminin G-like module 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028426
Domain Number - Region: 225-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000181
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028426   Gene: ENSMODG00000023106   Transcript: ENSMODT00000030008
Sequence length 257
Comment pep:novel chromosome:BROADO5:1:645113587:645114357:1 gene:ENSMODG00000023106 transcript:ENSMODT00000030008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTALLQRGGCFLVCLSLLLLGCWAELGSGLEFPGADGQWTRFPKWNACCESEMSFQLKT
RSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPAILLSDTPVNDGTWHTVRIR
RQFRNTTLLIDQTETKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPF
KGWIRDVRVNSSQALPVESGEVKLEDEPPSSGGGSPCEVGEEGEGGVCLNGGVCSVVDDK
AVCDCSRTGFRGKDCSQ
Download sequence
Identical sequences F7ACN3
13616.ENSMODP00000028426 ENSMODP00000028426 ENSMODP00000028426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]