SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028571 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028571
Domain Number 1 Region: 25-177
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-19
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 2 Region: 403-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000167
Family EGF-type module 0.002
Further Details:      
 
Domain Number 3 Region: 368-477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.0071
Further Details:      
 
Domain Number 4 Region: 281-400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000046
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 241-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000928
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028571   Gene: ENSMODG00000023139   Transcript: ENSMODT00000030155
Sequence length 558
Comment pep:novel chromosome:BROADO5:1:598165412:598167088:1 gene:ENSMODG00000023139 transcript:ENSMODT00000030155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPFLLPLLSILTMAELGLPASPALQPGGSQCIEDDCYAVFWSPEQFTGANLVCQQFGGH
LMTVRSSVAADVISLLAQGGSEISLPASRLWIGLELEQNCSHEQKGQLRGFRWVTGDTST
SYSKWKHSGRGALCGHQCVVVSEDSASGSVELVWEEHSCDLVTEGFLCEYNYFGSCKPLN
LEPSIGVNVTYSTPFGGKGADFQALPLNSHALVVPLGLDLVCKKVEDTPRWSKESLGPWD
CRVENGGCSQICSQDNGNPECLCSQGTLSKADLRSCLTEGDLCNPGRCDQYCQLSSEAPG
GYTCMCDSGYYLGEDGHSCIDVDDCALDPNPCPQKCVNTLGAFKCECNPGFELLDSECVE
LLDPCFGIQCQHKCLPLEGGAYRCICKEGFMPIPDQPDRCMSFCNTSECPAICNPYNPDD
CQCPDGYILDEDQMCSDIDDCAADECRGGECINLPGSFQCICPPPYTLSRTGQECILIEI
VSGDEGSGTIPSTEATGPTTSSPVAGPIHSVVLIGIAVSILSIITVLLATICHLRKKKYS
AQATLDYKCAGPTKEEVL
Download sequence
Identical sequences F7D9A3
ENSMODP00000028571 ENSMODP00000028571 XP_007476681.1.35504 13616.ENSMODP00000028571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]