SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028728 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028728
Domain Number 1 Region: 462-758
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-84
Family Pancreatic carboxypeptidases 0.00000000272
Further Details:      
 
Domain Number 2 Region: 40-347
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.26e-74
Family Pancreatic carboxypeptidases 0.00000124
Further Details:      
 
Domain Number 3 Region: 890-1175
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.36e-65
Family Pancreatic carboxypeptidases 0.0000147
Further Details:      
 
Domain Number 4 Region: 759-838
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.55e-18
Family Carboxypeptidase regulatory domain 0.000035
Further Details:      
 
Domain Number 5 Region: 1176-1272
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000102
Family Carboxypeptidase regulatory domain 0.0074
Further Details:      
 
Domain Number 6 Region: 347-399
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000255
Family Carboxypeptidase regulatory domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028728   Gene: ENSMODG00000009938   Transcript: ENSMODT00000030310
Sequence length 1342
Comment pep:novel chromosome:BROADO5:2:515167311:515244262:1 gene:ENSMODG00000009938 transcript:ENSMODT00000030310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPALLAHIKKAGATATATAPAPWAPAAASEPGPDPESADPFGRYYHEAELGAELAKAARP
GLGRLYSLGRSLEGRPLWALRLTAGLEGQGQGQEPSAVKLVGNMHGDETVSRQVLVYLAR
ELVAGYERGDPRLVRLLNSTDVHLLPSLNPDGFEHSREGTCDPAPADGGAGRYNSRGHDL
NRSFPDQFGTGEPPALDEVPEVRAVIEWIRSNNFVLSGNLHGGSVVASYPFDDSPQHKTS
GIYSRTDDDEVFKYLARSYASKHPIMRTGDPRCPSDEDETFKDGITNGAHWYDVEGGMQD
YNYMWSNCFEITLELSCCKYPPASQLRQEWENNRESLITFIEKVHMGVKGFVKDSASGSS
LENATISVAGINHNITSSKGGEFYRLLVPGTYNITAVSYQNCLCDEVTAKKQQQLNLSLS
GSGSVTQFVLVPVMPHTVAPVPTVAPAMDAPDTPASPQPIQPQDFHHHHFPDMEIFLRRF
ANEYPNITRLYSLGKSVESRELYVMEISYNPGVHEPGEPEFKYIGNMHGNEVVGRELLLN
LIEFLCKNFGTDPEVTELVRNTRIHLMPSMNPDGYEKSLEGDSTGVTGRNNSNNFDLNRN
FPDQFFQISDPVQPETTAVMSWLKTYPFVLSANLHGGSLVVNYPYDDDEQGVPSYSRSPD
DAIFQHLALSYSKENSEMYQGTSCKDMYPDEHFSHGITNGANWYSVSGGMQDWNYLNTNC
FEVTIELSCTKYPYEKDLPKYWEQNRRALVQFMKQVHHGVRGFVLDATDGRGILNATISV
ADINHPVTSYKSGDYWRLLVPGMYRITASARGYNPVTKNVTVKEEGAVQVNFTLVRSSSD
SRNNKSNKVKEMVADEGARDPVTKEFEALIKDLSAENGLERLMLSSSPNLALYRYHSYKD
LSEFLRGLVMNYPHITNLTNLGQSAEFRQIWSLEISNKPNMSEPEEPKIRFVAGIHGNAP
VGTELLLALAEFLCLNYKRNPAVTKLIDRTRIVIVPSLNPDGRERAQEKACTSTTGQSNA
RGKDLDTDFTSNAFQPETKAIIENLIQKQDFSLSVALDGGSVLVTYPYDKPVQTVENKET
LRHLASLYANNHPSMHMGQPSCPNKSDENIPGGVIRGAEWHGHMGSMKDYSVVYGHCPEI
TVYTSCCYFPSAGQLPTLWAENKKSLLSMLVEVHKGVHGIVQDKSGKPVSKAVIVLNEGI
KVHTKEGGHFHVLLAPGFHNINAIAEGYQQQHSQVFVHHDAASSVVIVFDTDNRIFGLPR
ELVVTVAGATMSALVLTACIIWCVCSIKSNRHKDGFHRLRQHHDDYEDEIRLMSTGSKKS
LLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences F7D7Y9
13616.ENSMODP00000028728 ENSMODP00000028728 ENSMODP00000028728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]