SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028751 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028751
Domain Number 1 Region: 334-451
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.33e-22
Family Canonical RBD 0.00000959
Further Details:      
 
Domain Number 2 Region: 494-533
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000000165
Family Ran binding protein zinc finger-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028751   Gene: ENSMODG00000010492   Transcript: ENSMODT00000013385
Sequence length 622
Comment pep:novel chromosome:BROADO5:1:576318900:576320768:-1 gene:ENSMODG00000010492 transcript:ENSMODT00000013385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTDYSTYSQAAAQQDYSAYAAQPAQGYAQTTQACGQQSYGDYEQPTDVSYTQAQTTAM
YGQTAYATSYGQPPTGYTTPTSPQAYSQPVQEYGPGAYDTTTATVTTTQASYAAQSAYGT
QPAYPTYGQQPARPQDGSKPAETSQPQSSTAGYSQPSLGYGQSNYSYPQGPGSDPRQPVT
APPSYPPTSYSSTQPTSYDESSYSQQNTYGQQSIYGQQSGYGQQPPTSGPPQTGSYSQAP
SQSSQQSSSYGQQSAFQQDHPSSMGVYGQESGGFSGSGENQSMSGPDDPGRGRGGFDCGG
MSRGGRGGGGGGHGGMGSAGERGGFSKPGGPMEEAPDLDLGPPVDPDEDPENSAIYVQGL
NESVTADELADFFKQCGVVKMNKRTGQPVINIYLDKETGKPKGDATVSYDDPPTAKAAVE
WFDGKDFQGSKLKVSLARGGMPPREGRGMPPPLRGGPEGPGGPGGPMGRMGGRGGDREGF
PPRGPRGSRGNPSGGENVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGRGGPGGM
RSGRGGLMDHGGPGGMFRGGRGGDRGDFRGGRGMDQGDFGGGRRRGPGGPPRPLMEQMGG
RRGGHGRPGKGERRQERRDRPY
Download sequence
Identical sequences F7CNF0
ENSMODP00000028751 13616.ENSMODP00000028751 ENSMODP00000028751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]